PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009147622.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SBP
Protein Properties Length: 190aa    MW: 21864.5 Da    PI: 10.331
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009147622.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.72.9e-4260135277
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     Cqv++C+adl+eak+yhrrhkvCevh+ka++v+++g++qrfCqqCsrfhel efDe+krsCr+rLa+hnerrrk++
  XP_009147622.1  60 CQVDRCTADLKEAKQYHRRHKVCEVHAKASSVYLTGVKQRFCQQCSRFHELLEFDEAKRSCRKRLAGHNERRRKSS 135
                     **************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.7E-3354121IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.96657134IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-3859138IPR004333Transcription factor, SBP-box
PfamPF031103.3E-3260133IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009908Biological Processflower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MDGKKTQGQG YLKKKASVSY LVEEELENDT DGEEEEKRKC VTDRFKGSSG SNDRGSSRLC  60
QVDRCTADLK EAKQYHRRHK VCEVHAKASS VYLTGVKQRF CQQCSRFHEL LEFDEAKRSC  120
RKRLAGHNER RRKSSGESIG EGSGGRRGIT AQMIQNQERS RIRVRSVTYP KAQKNNRKQP  180
PRLLNFQSHE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-4547133184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009147622.11e-138PREDICTED: squamosa promoter-binding-like protein 4 isoform X1
SwissprotQ9S7581e-70SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBLM4FEY41e-105M4FEY4_BRARP; Squamosa promoter-binding-like protein
STRINGBra039656.1-P1e-105(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.22e-51squamosa promoter binding protein-like 4