PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009147497.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 624aa    MW: 70173.6 Da    PI: 5.3661
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009147497.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY94.48.2e-30266323259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dg++WrKYGqK vkg+++prsYY+C+++gC +kk+ver+a+d +++ +tY g+H h 
  XP_009147497.1 266 NDGHRWRKYGQKIVKGNPNPRSYYKCSHKGCIMKKHVERAADDLRMLLVTYYGKHGHA 323
                     7******************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.4E-30251325IPR003657WRKY domain
PROSITE profilePS5081131.364260325IPR003657WRKY domain
SuperFamilySSF1182904.84E-26260325IPR003657WRKY domain
SMARTSM007744.2E-33265324IPR003657WRKY domain
PfamPF031064.6E-24266322IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 624 aa     Download sequence    Send to blast
MSDYGDGNFM DMVSSRWAPP LSTSLSDNGL NPISDIFLQT NQSKQRPGLV DRVAARIGRN  60
IPPIRTDNLS PCAVVFKDPK TVPFGIEISP GLSPSVMLQS RSQLINPYSF PNDEPPETVE  120
NSGDDHAKTM IFNKDVPYQP MHFDLPPQEA LIPSHVDPIG APLVASFESE VADDTDTKLM  180
SLDDESESQD EEESNEDEDT DDPSKLGRKR RIDEEEDDDI ADEHEVKPSS PKRRKYDEVS  240
NMMTALRASN NPRVRLRMET EEAQPNDGHR WRKYGQKIVK GNPNPRSYYK CSHKGCIMKK  300
HVERAADDLR MLLVTYYGKH GHAAPLARSS SSSGPKNLYR SSVPARLGRP PFSSSSAAQD  360
MRSFPYPSAS APRDMKRFGY PSALAPQAMR PFPSSLNPGV DMTHLYKTGL SKLPSLPVNQ  420
NHGFMDQNAE PWVNQNHGFM GQNAEPRVNQ NHGFMSQNAE PQVNQNHGFM GQNAEPWVNQ  480
NHGFMGQNAE PRVNQNHGFM GENVEPQVNQ NHGFMGQNVE PQVNQNHGFM GQNDEPWLNQ  540
NHGFMGQNDE PWLNQNHGLM DQNDEPWVNQ NHGFIGQNDE PWLNQNYGFM GQNDEPKTDH  600
VIPDGTEVYK GLRERMLANL GVKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-212663251877Probable WRKY transcription factor 4
2lex_A4e-212663251877Probable WRKY transcription factor 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009147497.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009147496.10.0PREDICTED: probable WRKY transcription factor 10
TrEMBLM4FA920.0M4FA92_BRARP; Uncharacterized protein
STRINGBra038006.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G55600.14e-43WRKY DNA-binding protein 10