PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009147391.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 457aa    MW: 49843.4 Da    PI: 9.035
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009147391.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.64.6e-32197253259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     dDgynWrKYGqK++kg e+prsYYrCt+ +Cpvkkkvers+ d+++++i+Y+g+H+he
  XP_009147391.1 197 DDGYNWRKYGQKPIKGCEYPRSYYRCTHVNCPVKKKVERSS-DGQITQIIYKGQHDHE 253
                     8****************************************.***************8 PP

2WRKY104.65.3e-33341399159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+Ct+a+C+v+k+ver+++d k+v++tYeg+Hnh+
  XP_009147391.1 341 LDDGYRWRKYGQKVVKGNPHPRSYYKCTTANCTVRKHVERASTDVKAVITTYEGKHNHD 399
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.3E-28188255IPR003657WRKY domain
SuperFamilySSF1182901.31E-25194255IPR003657WRKY domain
SMARTSM007741.1E-35196254IPR003657WRKY domain
PfamPF031067.6E-25197252IPR003657WRKY domain
PROSITE profilePS5081124.076197255IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.8E-36326401IPR003657WRKY domain
SuperFamilySSF1182905.62E-29333401IPR003657WRKY domain
PROSITE profilePS5081137.711336401IPR003657WRKY domain
SMARTSM007741.3E-37341400IPR003657WRKY domain
PfamPF031063.3E-25342399IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006468Biological Processprotein phosphorylation
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004672Molecular Functionprotein kinase activity
GO:0005524Molecular FunctionATP binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MAVEDDVSSM RTTTLVAPTR PTITVPQRPP AIETAAYFFG GGEGLSLSPG PLSFVSSLFV  60
DSFPDVLTPD NQRTTSFSQL LAGAMSVSPG SGRSTAGMIA GGGPLFTIPS GLSPSSLLTS  120
PMFFPPQSPT QTVFIQPQSQ PKRPDSFPNQ MPPSTSTAVH GRRSCKAPQA DRYNNPAANN  180
NNTNRSYNVV NVDKPADDGY NWRKYGQKPI KGCEYPRSYY RCTHVNCPVK KKVERSSDGQ  240
ITQIIYKGQH DHERPQNRRG GGGGVRDSGE IGDIHYIGGV GHIESSDDSG YANDHDNDND  300
DDNEDIPGSK KRKIDGGVST THRSVTEPKI VVQTRSEVDL LDDGYRWRKY GQKVVKGNPH  360
PRSYYKCTTA NCTVRKHVER ASTDVKAVIT TYEGKHNHDV PAARNGTAAI SAIAGTSDHH  420
RMRSLSGNNV QQHMSFDNTG QSPVLLRLKE EKLMVIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-38197402878Probable WRKY transcription factor 4
2lex_A6e-38197402878Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009147391.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4300650.0KF430065.1 Brassica rapa WRKY transcription factor 58 (WRKY58) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013750967.10.0probable WRKY transcription factor 58 isoform X2
SwissprotQ93WU70.0WRK58_ARATH; Probable WRKY transcription factor 58
TrEMBLA0A397ZI900.0A0A397ZI90_BRACM; Uncharacterized protein
STRINGBra039147.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01080.11e-161WRKY DNA-binding protein 58
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]