PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009147196.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 302aa    MW: 34958.1 Da    PI: 6.9138
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009147196.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF53.43.3e-171150342
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                    i n+s r+ tf kR++g +KK +ELSvLC+++++ +i+s+
  XP_009147196.1 11 ITNDSMRKSTFNKRKKGFFKKIHELSVLCGIQACAVIYSP 50
                    89************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.4E-23160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.353149IPR002100Transcription factor, MADS-box
CDDcd002661.54E-33285No hitNo description
SuperFamilySSF554555.36E-24295IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-7323IPR002100Transcription factor, MADS-box
PfamPF003192.5E-161150IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-72338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MTRKKLNISY ITNDSMRKST FNKRKKGFFK KIHELSVLCG IQACAVIYSP FSSTPDVWPS  60
NSEAKKVVEK FEEIPKIDQE KKMVNHEGFL RDSITKTRET TIKKMMDNTE SAMNETMFQF  120
LRGRGDMFQL TDKHRDDLCR HIDQHLKELY HHRKLILNQS HLEYGESSSA ANAMTQPAAI  180
AEEGSSPFPD PDAFNTAQPV NELWALENNY PPAASDQQGY YQMTNPVGGY HQHPSLNLNF  240
NPNQYQQKFV GYPNVAQDGN YSGIQNQNHQ QEEWLVSQMI NNSNQVRFPM MDDNNRYNYD  300
QP
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009147196.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009147196.10.0PREDICTED: agamous-like MADS-box protein AGL80 isoform X1
TrEMBLM4FE830.0M4FE83_BRARP; Uncharacterized protein
STRINGBra039404.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.11e-102M-type_MADS family protein