PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009146754.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 205aa    MW: 22785.2 Da    PI: 8.4864
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009146754.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.98.4e-39441431100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+l+r+C++ C++ap+f ++++ +fa vhk+FGasnv+kll+++pee+r+++++sl+yeA++r++dPvyG++g i +lq+++ +l++++a
  XP_009146754.1  44 SCAACKLLKRRCTPTCIFAPHFRSSDQITFAKVHKVFGASNVSKLLSEVPEEQRQETVNSLAYEADVRLKDPVYGCIGAIASLQKKMLELQHDIA 138
                     6*********************************************************************************************9 PP

          DUF260  96 llkee 100
                     +++++
  XP_009146754.1 139 VARNR 143
                     99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.543144IPR004883Lateral organ boundaries, LOB
PfamPF031954.0E-3844141IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MLIKNPIIYK GNHQINLTIN HSLTFYHPKR RFEMRGHEPR SSSSCAACKL LKRRCTPTCI  60
FAPHFRSSDQ ITFAKVHKVF GASNVSKLLS EVPEEQRQET VNSLAYEADV RLKDPVYGCI  120
GAIASLQKKM LELQHDIAVA RNRLLAHNAA GGVNNNNSHL LVSPLVDDAS QLAAFLDLVP  180
YSDLMLLDGS GLDAYLFDIG QPPFV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-39391536122LOB family transfactor Ramosa2.1
5ly0_B3e-39391536122LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009146754.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2546081e-135AC254608.1 Capsella rubella clone CAP16-D12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009146754.11e-152PREDICTED: LOB domain-containing protein 21
SwissprotQ9SRL81e-101LBD21_ARATH; LOB domain-containing protein 21
TrEMBLA0A291LR031e-150A0A291LR03_BRARR; Transcription factor LBD21
STRINGBra034867.1-P1e-124(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM102552735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.18e-91LOB domain-containing protein 21
Publications ? help Back to Top
  1. Weber AP,Weber KL,Carr K,Wilkerson C,Ohlrogge JB
    Sampling the Arabidopsis transcriptome with massively parallel pyrosequencing.
    Plant Physiol., 2007. 144(1): p. 32-42
    [PMID:17351049]