PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009146430.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRF
Protein Properties Length: 390aa    MW: 43942 Da    PI: 8.2686
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009146430.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.36.6e-2481125145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRCsr++ +++k+CE+H+hrgr+r rks ++
  XP_009146430.1  81 DPEPGRCRRTDGKKWRCSREAHPDSKYCEKHMHRGRNRARKSIDQ 125
                     79***************************************9875 PP

2QLQ63.17.2e-221651237
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                    +FT++Q+q+L++Q+l+yKy+++++PvPpeL++ i++
  XP_009146430.1 16 PFTPTQWQELENQALIYKYMVSGVPVPPELIFSIRR 51
                    9*******************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.7E-141551IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.4251651IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.2E-161650IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.25181125IPR014977WRC domain
PfamPF088792.1E-2082122IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MMSLSGNGGR TIERPPFTPT QWQELENQAL IYKYMVSGVP VPPELIFSIR RSLDSSLVSR  60
LLPHQSIGWG CYQMGFGRKP DPEPGRCRRT DGKKWRCSRE AHPDSKYCEK HMHRGRNRAR  120
KSIDQNQTTA PLTSPSLSFP NNNNPSPTLS SSSSTYSASS SSPSIDAYSN INRLGVGNSN  180
SRGYFNNHSL DYPYPLSSPK QQQQQQTLHH ASALSLHQNA STASQFNALA SATDHKDFRY  240
FQGIGERVGV GAGERTFFPE ASRSFQDSPY HHQQPLATVM NDPFHSGTDH KVDHQHHTYS  300
SVSSSSQHDQ DHHRQQQQQC FVMGADMFNK PTRTVFANSS RQDHQEEEEK DSSETKKSLH  360
HFFGEDWAQN KNSSDSWLDL SSHSRLDTGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1026380.0AY102638.1 Arabidopsis thaliana transcription activator (GRF5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009146430.10.0PREDICTED: growth-regulating factor 5-like
SwissprotQ8L8A60.0GRF5_ARATH; Growth-regulating factor 5
TrEMBLM4EF220.0M4EF22_BRARP; Uncharacterized protein
STRINGBra027384.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45672651
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-162growth-regulating factor 5