PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009146054.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GATA
Protein Properties Length: 166aa    MW: 17769.2 Da    PI: 9.1452
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009146054.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.38.7e-184175135
            GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                    C+ Cgt  TplWR gp g+k+LCnaCG++ rkk++
  XP_009146054.1 41 CVDCGTFRTPLWRGGPAGPKSLCNACGIKSRKKRQ 75
                    *********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004014.7E-133591IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.43571IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.57E-123677No hitNo description
Gene3DG3DSA:3.30.50.101.8E-143975IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.23E-114088No hitNo description
PfamPF003201.3E-154175IPR000679Zinc finger, GATA-type
PROSITE patternPS0034404166IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MSDGSEETKT KLDSSGESSD VDNENCISSG GGSSAEAKRT CVDCGTFRTP LWRGGPAGPK  60
SLCNACGIKS RKKRQAALGI KPEKKIRKSI IITSDTSDLS LEDDDHKTCS SSSSKGISRF  120
LDLGFKVPVM KRSSVEKKKR LWSKLGEEER AAAVLLMALS CASVYA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009146054.11e-116PREDICTED: GATA transcription factor 17-like
SwissprotQ9LIB52e-67GAT17_ARATH; GATA transcription factor 17
TrEMBLM4E0871e-116M4E087_BRARP; Uncharacterized protein
STRINGBra022184.1-P1e-115(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM126431528
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16870.15e-65GATA transcription factor 17