PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009145947.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 351aa    MW: 40014.8 Da    PI: 8.3003
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009145947.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.34.6e-2275134357
                     --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                     +R+++t++ql++Leel+++ +r+psa+++++++++l    +++ ++V++WFqN++a+e++
  XP_009145947.1  75 SRWNPTPDQLKALEELYQQgTRTPSADHIQQITAQLrrygKIEGKNVFYWFQNHKARERQ 134
                     7*****************99**************************************97 PP

2Wus_type_Homeobox115.23.1e-3774136365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ++RW+Ptp+Q+k Leely++G+rtP++++iq+ita+L++yGkie+kNVfyWFQN+kaRerqk+
     XP_009145947.1  74 SSRWNPTPDQLKALEELYQQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARERQKR 136
                        79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.99770135IPR001356Homeobox domain
SMARTSM003898.3E-672139IPR001356Homeobox domain
SuperFamilySSF466893.5E-1275140IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-975134IPR009057Homeodomain-like
PfamPF000469.0E-2075134IPR001356Homeobox domain
CDDcd000861.91E-676136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048513Biological Processanimal organ development
GO:0099402Biological Processplant organ development
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MWMMGYNEGG ADSFNGGRKL RPLIPRLSSC PSAAANTNSD HRFNMVMATM TAEQNKRELM  60
MLNSEHQHPP MMVSSRWNPT PDQLKALEEL YQQGTRTPSA DHIQQITAQL RRYGKIEGKN  120
VFYWFQNHKA RERQKRRRQM ENGHDESVFT TTSLVSNHGF DKKYPPGYKV EQTKKWICSV  180
GCDTQPQKPH ELHHQEEPVS IALPTKGNGR YVGNERQSFP GRNAMSQMMQ LAPGHYPYSR  240
QQQHHHELIL NSTTVTSSFS ASNSTVSAAK DTVTVTPLFL RTRAATNTGT CDDNKDQERH  300
EDCVNGELDH QEKTLELFPL RKEGFCISGG DDGKEKESGI HCFYEFLPLK N
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Specifically expressed during initiation of the shoot apical meristem, when cotyledonary primordia arise at the flanks of the apical embryo domain phase. Confined to the initiating vascular primordium of the cotyledons during heart and torpedo stages, but only weakly expressed during bent cotyledon stage. {ECO:0000269|PubMed:14711878}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009145947.1
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2513940.0AY251394.1 Arabidopsis thaliana WOX1 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009145947.10.0PREDICTED: WUSCHEL-related homeobox 1
SwissprotQ6X7K00.0WOX1_ARATH; WUSCHEL-related homeobox 1
TrEMBLM4E0H00.0M4E0H0_BRARP; Uncharacterized protein
STRINGBra022267.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73972741
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.10.0WUSCHEL related homeobox 1
Publications ? help Back to Top
  1. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]