PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009145269.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 553aa    MW: 60802.6 Da    PI: 8.234
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009145269.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.15.5e-16280318240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+CnCk+skClk+YCeCfaag++C   C+C dC+Nk 
  XP_009145269.1 280 SCKRCNCKRSKCLKLYCECFAAGVYCIGPCSCVDCFNKP 318
                     689**********************************96 PP

2TCR52.51e-16366404139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     ++k+gCnCkks+ClkkYCeC+++g+ Cs +C+Ce+CkN 
  XP_009145269.1 366 RHKRGCNCKKSNCLKKYCECYQSGVGCSINCRCEGCKNA 404
                     589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.3E-18279320IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.513280406IPR005172CRC domain
PfamPF036389.4E-12282317IPR005172CRC domain
SMARTSM011144.2E-17366407IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.0E-12368404IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 553 aa     Download sequence    Send to blast
MDTPPKNNSP VFNYINSLSP IKPVRSLPIA QTFGSLSYSS PPSVFTSPHV SSHKGSRFKS  60
DHNHVPASVG DEEALHETEP PQILQNECTT DLLKMCDGNV KQKSETPDWD AMISDSSDIL  120
IFDSMYDSEA SRCFLERPSD SKTRSLGVAK STLEPVINSN DALRRGVRRR CLDFDQTSVA  180
SSSRCVVPSI GLHFNAIALS SKDNNSGNEY PLSGNTELGL QGSITPVLNS QDNVRENETR  240
EDAGQGVEEC PKSLALVELN QSSPKKKRRK FGQAGEGESS CKRCNCKRSK CLKLYCECFA  300
AGVYCIGPCS CVDCFNKPIH EDIVMATRKQ IESRNPLAFA PKVIRNSDSI MEVGDDATSK  360
TPASARHKRG CNCKKSNCLK KYCECYQSGV GCSINCRCEG CKNAFGRKDV SAGSSFTSMD  420
KENETSSRGR TEKQPSTPMP LRQPLAQLPI SSNNMLLTHH HLHGASGSSL HMSQSFRRQD  480
MSLMSHSKIG TITEERAENI ENLIESPMTN MINAVSPNSK RVSLPMELSP WRRNGGRKLL  540
LSIPTFPSLT PHH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1628240312120Protein lin-54 homolog
5fd3_B1e-1628240312120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1264268KKKRR
2264269KKKRRK
3265269KKRRK
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers and at significant levels in leaves. Detected with highest levels in developing ovules and microspores, and in petals. {ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009145269.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018514565.10.0PREDICTED: protein tesmin/TSO1-like CXC 3
SwissprotQ8L5480.0TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
TrEMBLM4EYM80.0M4EYM8_BRARP; Uncharacterized protein
STRINGBra033920.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]