PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009145195.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 392aa    MW: 44298 Da    PI: 8.7057
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009145195.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94e-32218271255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  XP_009145195.1 218 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 271
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15215271IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28216271IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-23218271IPR006447Myb domain, plants
PfamPF002492.6E-7219270IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSK PSSTWQRRRS TPDQEEHGEL DLGFWRRALD SRTSSLVSSN  60
SSSKTTNNHH HPLGDLSLSN NSHQHQQQHQ HPLLLPNCNG SNILTSFQFQ TQQQQGFLAH  120
DLNTHLRPIR GIPLYQNHHP HHHHRPPPPY FPFDPSSLIP SSSVTPTATN NSFGTSSVSN  180
SGLITNPNYH NHQHHHHQTL NRARFMPRFP AKRSMRAPRM RWTTTLHARF VHAVELLGGH  240
ERATPKSVLE LMDVKDLTLA HVKSHLQMYR TVKTTDKAAA SSGQSDVYEN GSSGDNNSDD  300
WMFDINRKSR DSDELMNPLE KSNGLWTNSS GEARLHGKLI DNVAEIMLPS EKEIDGKCSS  360
YERISSEERS LSSISGTSPF KPNLEFTLGR YH
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.219650.0silique
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0292110.0BT029211.1 Arabidopsis thaliana At1g32240 mRNA, complete cds.
GenBankAY0486890.0AY048689.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI2 (KAN2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009145195.10.0PREDICTED: probable transcription factor KAN2
SwissprotQ9C6160.0KAN2_ARATH; Probable transcription factor KAN2
TrEMBLM4EYF20.0M4EYF2_BRARP; Uncharacterized protein
STRINGBra033844.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-162G2-like family protein