PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009145045.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 251aa    MW: 28555.1 Da    PI: 10.2194
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009145045.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.47.6e-2190149357
                     --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                     +R+++t+eq+++Le l++   r+p+a+++e+++++l    +++ ++V++WFqN++a+e++
  XP_009145045.1  90 TRWNPTQEQIKILEILYKGgMRTPNAQQIEHITSQLgkygKIEGKNVFYWFQNHKARERQ 149
                     7*****************99**************************************97 PP

2Wus_type_Homeobox116.41.3e-3790151465
  Wus_type_Homeobox   4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        tRW+Pt+eQikiLe lyk G+rtPn+++i++it++L +yGkie+kNVfyWFQN+kaRerqkq
     XP_009145045.1  90 TRWNPTQEQIKILEILYKGGMRTPNAQQIEHITSQLGKYGKIEGKNVFYWFQNHKARERQKQ 151
                        8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.94485150IPR001356Homeobox domain
SuperFamilySSF466891.45E-1286154IPR009057Homeodomain-like
SMARTSM003892.8E-787154IPR001356Homeobox domain
CDDcd000865.77E-590151No hitNo description
PfamPF000461.9E-1890149IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.0E-891149IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MKVHEFSNGF SSWEQQQESP SSFSCKRFRP LAPKLSGSPS SPPSSSSGVT SATFDLKSFI  60
KPDQAAPTKS HYSLEHKRDF SQVEMHPGGT RWNPTQEQIK ILEILYKGGM RTPNAQQIEH  120
ITSQLGKYGK IEGKNVFYWF QNHKARERQK QKRNNLSLSC QGSLSTTSVS NASVTMKTRT  180
SSSPDFKREP MVMKELLEEN EYKRTCRSWG FENLKIESRR NINSSINATI ATTFNIDNVT  240
LELFPLHPEG R
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009145045.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009145045.10.0PREDICTED: WUSCHEL-related homeobox 4-like
SwissprotQ6X7J91e-122WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBLA0A078I3Z80.0A0A078I3Z8_BRANA; BnaA05g18600D protein
TrEMBLA0A397ZHJ70.0A0A397ZHJ7_BRACM; Uncharacterized protein
TrEMBLM4ETT00.0M4ETT0_BRARP; Uncharacterized protein
STRINGBra032212.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59802747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.11e-118WUSCHEL related homeobox 4
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Dolzblasz A, et al.
    Stem Cell Regulation by Arabidopsis WOX Genes.
    Mol Plant, 2016. 9(7): p. 1028-39
    [PMID:27109605]
  3. Guo X, et al.
    Identification of cyst nematode B-type CLE peptides and modulation of the vascular stem cell pathway for feeding cell formation.
    PLoS Pathog., 2017. 13(2): p. e1006142
    [PMID:28158306]
  4. Denis E, et al.
    WOX14 promotes bioactive gibberellin synthesis and vascular cell differentiation in Arabidopsis.
    Plant J., 2017. 90(3): p. 560-572
    [PMID:28218997]
  5. Kucukoglu M,Nilsson J,Zheng B,Chaabouni S,Nilsson O
    WUSCHEL-RELATED HOMEOBOX4 (WOX4)-like genes regulate cambial cell division activity and secondary growth in Populus trees.
    New Phytol., 2017. 215(2): p. 642-657
    [PMID:28609015]
  6. Yamaguchi YL, et al.
    Root-Knot and Cyst Nematodes Activate Procambium-Associated Genes in Arabidopsis Roots.
    Front Plant Sci, 2017. 8: p. 1195
    [PMID:28747918]