PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009144664.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GeBP
Protein Properties Length: 300aa    MW: 34161.2 Da    PI: 5.7772
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009144664.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573101.66.6e-3236130397
          DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                     ++r+w+e+De+++L+Gl++++ kt  +ps d+d+f+  v++si++++sk+ql++K+r+L++Kf  +++++++g++p f++  d+++f++s++iWg
  XP_009144664.1  36 IKRIWNEDDELSILKGLVEYRVKTRHDPSFDWDGFFCSVQGSIHVRFSKEQLFSKVRKLRRKFVLHMERIDRGEDPLFTRLTDSQAFGYSNMIWG 130
                     68********************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.6E-2637130IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MKRLNFSDTS LQNSPSEEVS TKKNKNKKKK LASPVIKRIW NEDDELSILK GLVEYRVKTR  60
HDPSFDWDGF FCSVQGSIHV RFSKEQLFSK VRKLRRKFVL HMERIDRGED PLFTRLTDSQ  120
AFGYSNMIWG LNQAEVAANA GGTEKAPGDT QEDEHLDNAG HVNYNGVESS KLDGKESEFA  180
NGGMESVMQI ESDENGFREN GRVSNDEPVN ENGAEKGEVD GKETHDDELR VVEDAFETTI  240
LQGLSDWQRK LQLKKLMMNL GTEKRKELSN EWKALCSEEV KLKIKKLRFT VKLVEAANDG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.287460.0leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the apical meristem and young leaf primordia. Detected in the vascular tissues of cotyledons and leaves, in hydathodes and at the base of flowers and siliques, but not in roots. {ECO:0000269|PubMed:18162594}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. May play redundant roles with GEBP and GPL2 in cytokinin responses by regulating the transcript levels of type-A ARR response genes (PubMed:18162594). Involved in stress responses (PubMed:21875893). Plays a repressive role in cell expansion by counteracting the positive role of CPR5 in this process, but does not regulate cell proliferation or endoreduplication (PubMed:21875893). {ECO:0000269|PubMed:21875893, ECO:0000305|PubMed:18162594}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009144664.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009144664.10.0PREDICTED: GLABROUS1 enhancer-binding protein-like 1
RefseqXP_009144666.10.0PREDICTED: GLABROUS1 enhancer-binding protein-like 1
SwissprotQ8VYD21e-71STKLH_ARATH; GLABROUS1 enhancer-binding protein-like 1
TrEMBLA0A397Z9U60.0A0A397Z9U6_BRACM; Uncharacterized protein
TrEMBLM4FEH90.0M4FEH9_BRARP; Uncharacterized protein
STRINGBra039500.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61171741
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25650.11e-73DNA-binding storekeeper protein-related transcriptional regulator
Publications ? help Back to Top
  1. Khare D, et al.
    Root avoidance of toxic metals requires the GeBP-LIKE 4 transcription factor in Arabidopsis thaliana.
    New Phytol., 2017. 213(3): p. 1257-1273
    [PMID:27768815]
  2. Nietzsche M, et al.
    STOREKEEPER RELATED1/G-Element Binding Protein (STKR1) Interacts with Protein Kinase SnRK1.
    Plant Physiol., 2018. 176(2): p. 1773-1792
    [PMID:29192025]