PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009144110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 125aa    MW: 14561.8 Da    PI: 7.439
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009144110.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF32.51.1e-101151343
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                    i+n+s r+  +   + g+ KK  E+ vLCd++++ +i+s+ 
  XP_009144110.1 11 ISNDSVRKRALMHKKRGLTKKLDEIKVLCDIDACAVIYSPF 51
                    9**************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006613.26161IPR002100Transcription factor, MADS-box
SMARTSM004325.0E-10160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.79E-18183IPR002100Transcription factor, MADS-box
CDDcd002661.40E-17285No hitNo description
PfamPF003191.4E-81151IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MTRKKVNLAY ISNDSVRKRA LMHKKRGLTK KLDEIKVLCD IDACAVIYSP FNSTPEIWLP  60
NSEVHKVIEK FEILTDEEQT EASVNHEEFL TQTITKDEKK VKRLTEDNID KFMKELMYAC  120
LNGNL
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009144110.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009144110.12e-88PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLM4CLS95e-87M4CLS9_BRARP; Uncharacterized protein
STRINGBra005166.1-P8e-88(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28700.14e-43AGAMOUS-like 46