PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009143588.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRF
Protein Properties Length: 388aa    MW: 42731.2 Da    PI: 8.2666
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009143588.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC82.82.9e-26142186145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRCsr+v +g+k+CErH+hrgr+rsrk++e+
  XP_009143588.1 142 DPEPGRCRRTDGKKWRCSRDVFPGHKYCERHMHRGRNRSRKPVET 186
                     79****************************************996 PP

2QLQ53.76.4e-1973109137
             QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                     s F++aQ+q+L+ Q+l+y+y++a++ vP+eLl++i+k
  XP_009143588.1  73 SFFSWAQWQELELQALIYRYMLAGAAVPQELLLPIKK 109
                     67*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.3E-1273109IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.24774109IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.7E-1375107IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166726.714142186IPR014977WRC domain
PfamPF088794.8E-22143185IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MDLQLKQWRS QQKQQTESED QPSAAKIPKH VYDQIQSHTA TSTALPLFSP EPTSSKLSSL  60
SQDSSSRFPK MGSFFSWAQW QELELQALIY RYMLAGAAVP QELLLPIKKS LLHLSPSYFL  120
HHPLQHLPHY QPAWYMGKGA MDPEPGRCRR TDGKKWRCSR DVFPGHKYCE RHMHRGRNRS  180
RKPVETPTVN ATTSTPIAPA SAPATTASLF AFGGGEEVGQ GGGSSCFFFS GSGSSNSSSE  240
LLHLSQSSEL RQGSNNSNNK RPYESHNGFG NNISDGGHTL RHFFDDWPRS EADNSTTPMS  300
STTCLSISMP LNTSSDVSLK LSTGNEEEEA RSNNNGRDQQ NMSWWSGGGS LPNHHHMGGP  360
LAEVLRSSSS SSPTSVLHQL GVSTQAFH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0264720.0BT026472.1 Arabidopsis thaliana At2g36400 mRNA, complete cds.
GenBankAY1026360.0AY102636.1 Arabidopsis thaliana transcription activator (GRF3) mRNA, complete cds.
GenBankAK1174170.0AK117417.1 Arabidopsis thaliana At2g36400 mRNA for unknown protein, complete cds, clone: RAFL17-02-B13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013748432.10.0PREDICTED: growth-regulating factor 3
RefseqXP_009143588.10.0PREDICTED: growth-regulating factor 3-like
SwissprotQ9SJR50.0GRF3_ARATH; Growth-regulating factor 3
TrEMBLM4CM310.0M4CM31_BRARP; Uncharacterized protein
STRINGBra005268.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19262667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36400.11e-135growth-regulating factor 3