PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009142834.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family VOZ
Protein Properties Length: 474aa    MW: 52698.8 Da    PI: 5.7255
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009142834.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ411.31.7e-1262224361215
             VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaael 95 
                     pppsaflgpkcalwdctrpa+gs+w+ dycs +h +lal e++pgt+pvlrp+gi+lkd+ll++al+ak+ gk+vg p+cega+++k+pwnaael
  XP_009142834.1 222 PPPSAFLGPKCALWDCTRPAHGSDWYMDYCSDYHGNLALTEDSPGTAPVLRPGGISLKDNLLIDALRAKTLGKNVGSPVCEGAVNTKCPWNAAEL 316
                     89********************************************************************************************* PP

             VOZ  96 fdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklv 190
                     f+l+l+egetirewlffdkprra++sgnrkqrslpdysgrgwhesrkq+mke++g+krsyymdpqp++ fewhl+ey+ine+da+alyrlelkl+
  XP_009142834.1 317 FHLELVEGETIREWLFFDKPRRAYDSGNRKQRSLPDYSGRGWHESRKQLMKEQEGQKRSYYMDPQPPGPFEWHLFEYQINESDACALYRLELKLT 411
                     *********************************************************************************************** PP

             VOZ 191 dekksakgkvskdsladlqkklgrl 215
                     ++kks+kgkv+kd+ladl+kk+ ++
  XP_009142834.1 412 NGKKSPKGKVAKDPLADLEKKMEKM 436
                     ********************99876 PP

Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MSNHPKITCV SSSHQNLVEK LMQLQERFSH LQAARKEGRV NDHAVLEAQI SQNLREWQAE  60
LSAPSPESSL LGGSISQFSE EIARLLKLND EEDDATSSFK EHNVPKADAF DQGLCSPGQL  120
EWAAEPFDQS SFDVNFLSGF EDAVNNSGTH DHQLHCAFQE FDPSLSTAPD FHGQKLSHLD  180
ITSQLDYHLS EVRQEFNNGT PSVKLDVPDE SEFTTPPSVR VPPPSAFLGP KCALWDCTRP  240
AHGSDWYMDY CSDYHGNLAL TEDSPGTAPV LRPGGISLKD NLLIDALRAK TLGKNVGSPV  300
CEGAVNTKCP WNAAELFHLE LVEGETIREW LFFDKPRRAY DSGNRKQRSL PDYSGRGWHE  360
SRKQLMKEQE GQKRSYYMDP QPPGPFEWHL FEYQINESDA CALYRLELKL TNGKKSPKGK  420
VAKDPLADLE KKMEKMGKLT PEAASDKPSP TTKGRAKSTK GAKAAATGNL TQAT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.245950.0silique
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles and mesophyll cells of various tissues. Expressed in the root, especially in the root tip. Also detected in stamen filaments, stipules and anthers. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ1 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Binds as a dimer to the palindromic sequence 5'-GCGTNNNNNNNACGC-3'. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009142834.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. Down-regulated by far-red light (at protein level). {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1553370.0AC155337.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH117N09, complete sequence.
GenBankAC1892200.0AC189220.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB010H06, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009142834.10.0PREDICTED: transcription factor VOZ2
SwissprotQ9SLB90.0VOZ2_ARATH; Transcription factor VOZ2
TrEMBLA0A397Z6610.0A0A397Z661_BRACM; Uncharacterized protein
STRINGBra004691.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM110602534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42400.10.0vascular plant one zinc finger protein 2
Publications ? help Back to Top
  1. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  2. Koguchi M,Yamasaki K,Hirano T,Sato MH
    Vascular plant one-zinc-finger protein 2 is localized both to the nucleus and stress granules under heat stress in Arabidopsis.
    Plant Signal Behav, 2017. 12(3): p. e1295907
    [PMID:28277968]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]