PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009142548.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 319aa    MW: 36027.9 Da    PI: 6.6795
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009142548.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.72.4e-33155211258
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                     +Dgy+WrKYGqK vk+s+fprsYYrCt+a+C+vkk+vers +dp++v++tYeg+H+h
  XP_009142548.1 155 EDGYRWRKYGQKAVKNSPFPRSYYRCTTASCNVKKRVERSFRDPSTVVTTYEGQHTH 211
                     8******************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381305.2E-1131319IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.808.4E-34139213IPR003657WRKY domain
SuperFamilySSF1182901.57E-28146212IPR003657WRKY domain
PROSITE profilePS5081130.963149214IPR003657WRKY domain
SMARTSM007741.0E-38154213IPR003657WRKY domain
PfamPF031067.0E-26155211IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MEFTSFHQPS LQSIWDFGEE ERDSLGFMEL LGSQHHSLLL ETLQPQAQPF EKLSSSDLTI  60
LQAPPSNATA DKYVTSKVES LCSDINPPAT PNSSSISSAS SEAVDEDKAK REENEEHEQQ  120
KSDTKKQLKP KKNSQKRQRE ARIAFMTKSE VDHLEDGYRW RKYGQKAVKN SPFPRSYYRC  180
TTASCNVKKR VERSFRDPST VVTTYEGQHT HISPLTSRPI SSGGFFFGSS GVASNLGNFG  240
FPMESSTLIY PQFQQLVHYN QQQQQQQQEL FPCFGGVGEY VTRHADAYGD DERVKKSRGL  300
GKDNGLLQDV VPSHMLKEE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-28144214777Probable WRKY transcription factor 4
2lex_A7e-28144214777Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.249790.0root| silique
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009142548.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4300740.0KF430074.1 Brassica rapa WRKY transcription factor 68 (WRKY68) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288832.10.0probable WRKY transcription factor 23
SwissprotO229001e-141WRK23_ARATH; WRKY transcription factor 23
TrEMBLM4CJT20.0M4CJT2_BRARP; WRKY transcription factor
STRINGBra004466.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61522647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.11e-121WRKY DNA-binding protein 23
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Guo D,Qin G
    EXB1/WRKY71 transcription factor regulates both shoot branching and responses to abiotic stresses.
    Plant Signal Behav, 2016. 11(3): p. e1150404
    [PMID:26914912]
  4. PrĂ¡t T, et al.
    WRKY23 is a component of the transcriptional network mediating auxin feedback on PIN polarity.
    PLoS Genet., 2018. 14(1): p. e1007177
    [PMID:29377885]