PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009142342.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRF
Protein Properties Length: 438aa    MW: 49227.2 Da    PI: 9.6254
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009142342.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.55.5e-2497141145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+ep rCrRtDGKkWRCs++vl  +k+CErH+hrgr+rsrk +e+
  XP_009142342.1  97 DPEPTRCRRTDGKKWRCSNKVLLFQKYCERHMHRGRKRSRKLVES 141
                     79***************************************9986 PP

2WRC70.22.6e-22318362145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRCs++vl+g+k+C+rH+hrg+ ++++++e+
  XP_009142342.1 318 DSEPGRCRRTDGKKWRCSKDVLSGQKYCDRHMHRGSIKKKHPVET 362
                     689********************************9999999886 PP

3QLQ43.11.3e-153266337
             QLQ  3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                    + aaQlq++++Q+l+y+y+ a++ vP +L+++i++
  XP_009142342.1 32 MKAAQLQEFRMQALVYRYIEAGVRVPNHLVVPIWN 66
                    679*******************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.2E-73066IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166616.0043166IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.2E-93465IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.31297141IPR014977WRC domain
PfamPF088794.7E-2098140IPR014977WRC domain
PROSITE profilePS5166721.934318363IPR014977WRC domain
PfamPF088793.5E-18320360IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MEEKKHSLQS NKMQSPKTEE EDEWRRKKWP CMKAAQLQEF RMQALVYRYI EAGVRVPNHL  60
VVPIWNSLAL SSSSSSGYLI HHNYPSSSNA VLNDKVDPEP TRCRRTDGKK WRCSNKVLLF  120
QKYCERHMHR GRKRSRKLVE SSSSYDVASS FASTKRDNTD GLNSSTESHS VSHGAMSVSS  180
NAQVVTIASL PSARVCDNIP RPSLVVTEST NKSVRRRITD MSYDDFIKQR GATTCVRGFP  240
VQGSERLPSV QKFFPEASDN TSEAARISSN RKNEIIARSR EWKNMNVNCG GLFPGIHFSP  300
DTVLQDRGGF GLHRVETDSE PGRCRRTDGK KWRCSKDVLS GQKYCDRHMH RGSIKKKHPV  360
ETTHTHENTV KTAARSVTCQ DGDGQKLPVS VLGREQLSRV SDEKNTTNSC STDTTITDIA  420
LKGEEDNEEV LSLCSSGV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130137GRKRSRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009142342.10.0PREDICTED: growth-regulating factor 9
SwissprotQ8S9M31e-178GRF9_ARATH; Growth-regulating factor 9
TrEMBLM4FE130.0M4FE13_BRARP; Uncharacterized protein
STRINGBra039334.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM137602024
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45480.11e-175growth-regulating factor 9