PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009142314.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GATA
Protein Properties Length: 256aa    MW: 28181.2 Da    PI: 8.2863
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009142314.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.22.2e-18172206135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C++C + kTp+WR gp g+ktLCnaCG+++++ +l
  XP_009142314.1 172 CTHCASDKTPQWRTGPLGPKTLCNACGVRFKSGRL 206
                     *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.1E-872255IPR016679Transcription factor, GATA, plant
SMARTSM004015.4E-15166216IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.187170202IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.8E-13170204IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577162.33E-14170230No hitNo description
CDDcd002023.23E-14171218No hitNo description
PfamPF003202.9E-16172206IPR000679Zinc finger, GATA-type
PROSITE patternPS003440172197IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MDVYGLSSQD LLRVDDLLDF SNEDIFSASS STSTAATSSS SFPPQNPNYH HHHLPSSADH  60
SFLHDICVPS DDAAHLEWLS QFVDDSFADF PANPLGGTMT SVKTETSFTG KPRSKRSKPP  120
STLVGTWAPM SETDQNIHVA GRSKPKKEHS GGGGRHQSSS AETAEGAGLR RCTHCASDKT  180
PQWRTGPLGP KTLCNACGVR FKSGRLVPEY RPASSPTFVL TQHSNSHRKV MELRRQKEVM  240
RQPHQVQLHH HHHPSF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.319930.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009142314.10.0PREDICTED: GATA transcription factor 2-like
SwissprotO497411e-132GATA2_ARATH; GATA transcription factor 2
TrEMBLA0A078HJL60.0A0A078HJL6_BRANA; BnaA04g26010D protein
TrEMBLM4FGV10.0M4FGV1_BRARP; Uncharacterized protein
STRINGBra040329.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32032666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.11e-126GATA transcription factor 2