PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009141059.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 265aa    MW: 28772.6 Da    PI: 8.9991
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009141059.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.33e-3952150199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++ e++r da++slvyeA+ r+rdP+yG++g i++lq+++++l++el 
  XP_009141059.1  52 PCAACKLLRRRCAEECPFSPYFSPHEPHKFAAVHKVFGASNVSKMLLEVGESQRGDAANSLVYEANLRLRDPIYGCMGAISALQHHIQSLQSELT 146
                     7*********************************************************************************************9 PP

          DUF260  96 llke 99 
                     ++++
  XP_009141059.1 147 AVRT 150
                     9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.14251152IPR004883Lateral organ boundaries, LOB
PfamPF031954.3E-4052149IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MSRDREGFGD YYKIVKKVKK DPTFEKTMDH AVMGIRRHVA VPPGTTLNTV TPCAACKLLR  60
RRCAEECPFS PYFSPHEPHK FAAVHKVFGA SNVSKMLLEV GESQRGDAAN SLVYEANLRL  120
RDPIYGCMGA ISALQHHIQS LQSELTAVRT DILRHKYREA ATITSLQNNN NNFNNTTTTS  180
VSDHAALAAT ILLPPPLPPP HPPRPPRLLS SQPAPPVSLP SPSMVVPSSS SSNSSAGNSM  240
YNPPPSSAAG CSNSLSSDNN VHYFD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009141059.10.0PREDICTED: LOB domain-containing protein 13-like isoform X2
SwissprotQ9AT611e-131LBD13_ARATH; LOB domain-containing protein 13
TrEMBLM4DYN10.0M4DYN1_BRARP; Structure-specific endonuclease subunit SLX1 homolog
STRINGBra021627.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.11e-107LOB domain-containing protein 13