PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009140922.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 234aa    MW: 27143.2 Da    PI: 9.5053
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009140922.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox629.1e-20766357
                    --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                    +R+++t+eql +Lee++++  r+p+a ++++++++l    +++ ++V++WFqN++a++++
  XP_009140922.1  7 TRWCPTPEQLMILEEMYRSgIRTPNAVQIQQITAHLafygRIEGKNVFYWFQNHKARDRQ 66
                    7*****************99*************************************996 PP

2Wus_type_Homeobox119.71.2e-38667364
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                        tRW+PtpeQ++iLee+y+sG+rtPn+ +iq+ita+L+ yG+ie+kNVfyWFQN+kaR+rqk
     XP_009140922.1  6 ATRWCPTPEQLMILEEMYRSGIRTPNAVQIQQITAHLAFYGRIEGKNVFYWFQNHKARDRQK 67
                       79***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003890.0021471IPR001356Homeobox domain
CDDcd000864.25E-4767No hitNo description
PfamPF000461.7E-17766IPR001356Homeobox domain
SuperFamilySSF466896.84E-11767IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-7866IPR009057Homeodomain-like
PROSITE profilePS500719.7661267IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MSPVAATRWC PTPEQLMILE EMYRSGIRTP NAVQIQQITA HLAFYGRIEG KNVFYWFQNH  60
KARDRQKLRK KLAKQLHQQQ HHLQLQLQHI QPNPISQPLS NIIDPHNHYH HHYNHHRPYD  120
HMSFACCSQP SPICLSHQAI GVEAQSKVLS EHYCNKSGRE DMLMQKPITG QNTSYGRDWM  180
MMMMDMGPRP SYPSSSSVPV PYCNMMMNSP KIPLKTLELF PISSINSKQD SSKL
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First expressed in the L1 cells of the lateral regions of a flower primordium at early stage 1, in which the lateral sepals are expected to develop at a later stage. It then rapidly decreases at the late stage 1 and disappears at stage 2. At stage 3, it reappears in all four-sepal young primordia. Not detected at the central zone of the inflorescence meristem and the floral meristem. In stages 4 through 6, when four sepals develop to enclose the flower bud, it is localized at the lateral edges of the four sepals and forms an arch of the L1 cells at the margin of sepals. Expressed in the young primordia of petals and stamens. As the petals and stamens develop, it is limited at the margins of petals and stamens in a way similar to that of sepals. In the vegetative phase, it is expressed at the lateral regions of young leaf primordia, as well as in flowers and floral organs. {ECO:0000269|PubMed:11751640, ECO:0000269|PubMed:14711878}.
UniprotTISSUE SPECIFICITY: Expressed in aerial parts of seedlings, inflorescences and flowers at low level. Expressed in a restricted number of L1 cells at the lateral regions of flower primordia. {ECO:0000269|PubMed:11751640}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in the lateral sepal axis-dependent development of flowers, probably by regulating the proliferation of L1 cells at the lateral region of flower primordia. Required for the formation of the margin cells of the first and second whorl organs. {ECO:0000269|PubMed:11751640, ECO:0000269|PubMed:15169755}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009140922.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0589201e-105AB058920.1 Arabidopsis thaliana PRS mRNA for PRESSED FLOWER, complete cds.
GenBankAY2513971e-105AY251397.1 Arabidopsis thaliana PRS/WOX3 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009140922.11e-176PREDICTED: WUSCHEL-related homeobox 3
SwissprotQ9SIB41e-109WOX3_ARATH; WUSCHEL-related homeobox 3
TrEMBLA0A078H1Q61e-175A0A078H1Q6_BRANA; BnaA04g16520D protein
TrEMBLA0A397Y3Y31e-175A0A397Y3Y3_BRACM; Uncharacterized protein
TrEMBLM4F3N81e-175M4F3N8_BRARP; Uncharacterized protein
STRINGBra035688.1-P1e-176(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM74802642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.13e-96WOX family protein
Publications ? help Back to Top
  1. Chandler JW,Werr W
    Arabidopsis floral phytomer development: auxin response relative to biphasic modes of organ initiation.
    J. Exp. Bot., 2014. 65(12): p. 3097-110
    [PMID:24744428]
  2. Niu L, et al.
    LOOSE FLOWER, a WUSCHEL-like Homeobox gene, is required for lateral fusion of floral organs in Medicago truncatula.
    Plant J., 2015. 81(3): p. 480-92
    [PMID:25492397]
  3. Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL
    Active suppression of a leaf meristem orchestrates determinate leaf growth.
    Elife, 2017.
    [PMID:27710768]
  4. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]