PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009140266.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family BBR-BPC
Protein Properties Length: 286aa    MW: 31885.2 Da    PI: 9.4002
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009140266.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind65.81.9e-20311091595
       GAGA_bind  15 epaaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvenslasal 95 
                     e++++l   +++++ms++aerda+++ern+a+s+k +a+a+rd a+lqrdkalaer+kal+erdn+++al+++ensl++al
  XP_009140266.1  31 EQHNALV--MNKKIMSILAERDAAVHERNQAVSAKIEALAARDQALLQRDKALAERDKALIERDNAFAALQHHENSLNFAL 109
                     3556676..99****************************************************************998655 PP

2GAGA_bind245.43.7e-75139286154301
       GAGA_bind 154 qrakkpkekkak..kkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPv 246
                     +++k  k+kk++  k kk +e+ +  v++++  +++k+++++  ++ln v++De t+PvPvC+CtG+ +qCYkWGnGGWqS+CCttt+S yPLP+
  XP_009140266.1 139 NTTKAIKRKKENkpKGKKVGEDLNLLVAAPG--KKRKKDWDTNHFGLNLVTFDEKTMPVPVCTCTGSAHQCYKWGNGGWQSSCCTTTLSLYPLPQ 231
                     3333334444441144555777777788888..579*********************************************************** PP

       GAGA_bind 247 stkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     ++++r++R++grKmS+++f++lL++LaaeGydls  vDLkd+WA+HGtn+++ti+
  XP_009140266.1 232 KPNKRHSRVGGRKMSGNVFSRLLSHLAAEGYDLSSRVDLKDYWARHGTNRYITIK 286
                     ******************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012263.7E-1271286IPR010409GAGA-binding transcriptional activator
PfamPF062174.8E-8818286IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MENGGQCANG SDYLKGAHSM WNMLPHHQIK EQHNALVMNK KIMSILAERD AAVHERNQAV  60
SAKIEALAAR DQALLQRDKA LAERDKALIE RDNAFAALQH HENSLNFALS GGKRCQGADD  120
DDDDVLFTID DLCPTTSTNT TKAIKRKKEN KPKGKKVGED LNLLVAAPGK KRKKDWDTNH  180
FGLNLVTFDE KTMPVPVCTC TGSAHQCYKW GNGGWQSSCC TTTLSLYPLP QKPNKRHSRV  240
GGRKMSGNVF SRLLSHLAAE GYDLSSRVDL KDYWARHGTN RYITIK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1169173KKRKK
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and pistils. Detected in the base of flowers and tips of carpels, in sepal and petal vasculature, in anthers, in young rosette, in the lateral and primary roots, and in the whole ovule. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:21435046}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009140266.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009140266.10.0PREDICTED: protein BASIC PENTACYSTEINE4
RefseqXP_013743517.10.0protein BASIC PENTACYSTEINE4-like
RefseqXP_018514043.10.0PREDICTED: protein BASIC PENTACYSTEINE4
SwissprotQ8S8C61e-157BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLM4END80.0M4END8_BRARP; Uncharacterized protein
STRINGBra030308.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40902659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.21e-143basic pentacysteine 4