PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009139614.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GeBP
Protein Properties Length: 332aa    MW: 36619.3 Da    PI: 5.0743
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009139614.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573115.92.3e-3696187297
          DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                      fqrlwseeDe++lLqG+idfka+ gksp++d+d+fye ++ksisf++sk q+v+Kir+LK+K+ +k k+   g e s++k+hd ++++l+  iW
  XP_009139614.1  96 SFQRLWSEEDEVSLLQGMIDFKADSGKSPYEDMDRFYELASKSISFEASKIQFVDKIRSLKRKYMGKAKH---GAE-SLTKAHDIDCLKLATCIW 186
                     69****************************************************************9999...655.9***************** PP

          DUF573  97 g 97 
                     g
  XP_009139614.1 187 G 187
                     8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045048.8E-2897187IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MTKKKLTPLE DPPTASSTDD DQVEALSGDD EKEQISDDSS PDDLTNPVAI PSAKRSKSEK  60
PIAVTEPKAV KKRPIETTSV SAKRARTAEE AKKPSSFQRL WSEEDEVSLL QGMIDFKADS  120
GKSPYEDMDR FYELASKSIS FEASKIQFVD KIRSLKRKYM GKAKHGAESL TKAHDIDCLK  180
LATCIWGLAL DSNSSAKKLG KEEEEVVAPE SANGDKVEED REVLVSGDNG GEDRRVLAGG  240
EKDKEVLING GGASKCHGVR ADDWFEDSFL VGSIAGLGVS EQFVKQKWSM VTVETKKRME  300
KKWKLLQAKE MELVLHKTDF MREIGSVIAE AS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1296303KRMEKKWK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.61790.0flower| root| silique
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009139614.10.0PREDICTED: mediator-associated protein 1-like isoform X1
TrEMBLM4EV840.0M4EV84_BRARP; Uncharacterized protein
STRINGBra032717.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.16e-70DNA-binding storekeeper protein-related transcriptional regulator