PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009139002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SBP
Protein Properties Length: 309aa    MW: 34533.6 Da    PI: 9.4316
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009139002.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.21.3e-3959136178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +CqvegC++dls+ak+y++rhkvC +hsk+++v+vsgl+qrfCqqCsrfh+l efD ekrsCrrrLa hnerrrk+qa
  XP_009139002.1  59 RCQVEGCKMDLSNAKTYYSRHKVCGIHSKSSKVTVSGLHQRFCQQCSRFHQLCEFDLEKRSCRRRLACHNERRRKPQA 136
                     6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.7E-3054121IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.57357134IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.75E-3658137IPR004333Transcription factor, SBP-box
PfamPF031107.7E-2960133IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MELLMGSGQN RTETVGSSSR ESSSLSGGLR IGQKIYFEDG SGSGKDRANK YRKTTTGARC  60
QVEGCKMDLS NAKTYYSRHK VCGIHSKSSK VTVSGLHQRF CQQCSRFHQL CEFDLEKRSC  120
RRRLACHNER RRKPQATRAT LFTSGLSRIS PSLYGSVLGD PSWDRSVFSQ GSSRFSITYP  180
EMVKNSSTDS SCVLSLLSNS NTTQQQQQQL QTSTNAYLMD AERVTIMAKS PPVSVHNQYS  240
NQTWEFMSGE KSNSPCVSSP ALRLSQISEP DDDLQFLMSN GATMGGFELN LQQQVLRQYS  300
STQHFTWPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-29601331184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894690.0AC189469.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB078G17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009139002.10.0PREDICTED: squamosa promoter-binding-like protein 15 isoform X1
SwissprotQ9M2Q61e-118SPL15_ARATH; Squamosa promoter-binding-like protein 15
TrEMBLA0A078J9J30.0A0A078J9J3_BRANA; BnaA04g27550D protein
STRINGBra014599.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21442775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57920.11e-105squamosa promoter binding protein-like 15