PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009138860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family BBR-BPC
Protein Properties Length: 301aa    MW: 33712 Da    PI: 9.919
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009138860.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind346.18e-10613011301
       GAGA_bind   1 mdddgsre..rnkg.yyepa.aslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvensl 91 
                     mdd g+r+  r+k+ + +++ +s+k     q+ms+iaerd++i+ernla+se+k+avaerdmaflqrd+a+aern+a++erd++l+al++++ns+
  XP_009138860.1   1 MDDGGHRDngRHKApQGQHQqPSMK-----QVMSIIAERDTAIQERNLAVSERKSAVAERDMAFLQRDTAIAERNNAIMERDSALTALQYRDNSM 90 
                     9*****9888988843332236666.....*************************************************************9985 PP

       GAGA_bind  92 asalpvgvqvlsgtksidslqqlse.pqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesade 185
                     a++        ++ ++ +++ ql+e +  e   ++++   ++ +   + +++  +++k++k+ ++++ pk++++             vkke++d+
  XP_009138860.1  91 ATSR------QHQPHMPHHMLQLTEnNAYETREIGTSPPPTTGSALASAKPKRGRKVKEPKAAANKRGPKNQRK-------------VKKENEDD 166
                     5433......2223333333332221222222333333333333333444444444444444444444443333.............33333331 PP

       GAGA_bind 186 r................skaekksidl..vlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSq 262
                                      sk+++ks ++   ln+v +De+t+P+PvCsCtG+lrqCYkWGnGGWqS+CCttt+S++PLP+ +++++aR++grKmS+
  XP_009138860.1 167 LskimsldyseeeeatgSKSDWKSEEMmvRLNQVVYDETTMPPPVCSCTGVLRQCYKWGNGGWQSSCCTTTLSMHPLPALPNKKHARVGGRKMSG 261
                     12344455555556677*********96669**************************************************************** PP

       GAGA_bind 263 gafkklLekLaaeG.ydlsnpvDLkdhWAkHGtnkfvtir 301
                     +af+klL++LaaeG +dls pvDLkd WAkHGtn+++ti+
  XP_009138860.1 262 SAFNKLLSRLAAEGhHDLSSPVDLKDRWAKHGTNRYITIK 301
                     **************88***********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062177.6E-981301IPR010409GAGA-binding transcriptional activator
SMARTSM012261.3E-1351301IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MDDGGHRDNG RHKAPQGQHQ QPSMKQVMSI IAERDTAIQE RNLAVSERKS AVAERDMAFL  60
QRDTAIAERN NAIMERDSAL TALQYRDNSM ATSRQHQPHM PHHMLQLTEN NAYETREIGT  120
SPPPTTGSAL ASAKPKRGRK VKEPKAAANK RGPKNQRKVK KENEDDLSKI MSLDYSEEEE  180
ATGSKSDWKS EEMMVRLNQV VYDETTMPPP VCSCTGVLRQ CYKWGNGGWQ SSCCTTTLSM  240
HPLPALPNKK HARVGGRKMS GSAFNKLLSR LAAEGHHDLS SPVDLKDRWA KHGTNRYITI  300
K
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.31080.0flower
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and pistils. Detected in the base of flowers and tips of carpels, in sepal vasculature, in young rosette, in the lateral and tip of primary roots, and in ovule at the exception of the outer integument. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:21435046}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009138860.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892971e-109AC189297.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB027O09, complete sequence.
GenBankEF5295131e-109EF529513.1 Brassica rapa subsp. pekinensis GAGA-binding transcriptional activator (BBR/BPC6) gene, complete cds.
GenBankEF5295141e-109EF529514.1 Brassica rapa subsp. pekinensis GAGA-binding transcriptional activator (BBR/BPC6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009138860.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X3
SwissprotQ8L9991e-163BPC6_ARATH; Protein BASIC PENTACYSTEINE6
TrEMBLM4DDD60.0M4DDD6_BRARP; Uncharacterized protein
STRINGBra014504.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.21e-166basic pentacysteine 6