PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009138528.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRF
Protein Properties Length: 447aa    MW: 48570 Da    PI: 9.5963
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009138528.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.66.1e-25195238144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk +e
  XP_009138528.1 195 DPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKLVE 238
                     79***************************************998 PP

2QLQ54.63.2e-19131167137
             QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                     ++FT +Q+++L++Q+l+yKy+ an+PvP+ Ll  iqk
  XP_009138528.1 131 GPFTLTQWAELEQQALIYKYITANVPVPSSLLISIQK 167
                     59*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.1E-12131167IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.7E-13132166IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.884132167IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.463195239IPR014977WRC domain
PfamPF088793.2E-21196238IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MDIGTHVPGS VTSNVNGSPD LKEDRSGLPR SSKLAKTTTM AEDKSLSSPY AAAYSKSLGF  60
PLMRSASDSL RQEQMLSFSD KPEAQDFSKY VCLDNKNSLS PFLHQFPPQY RSYSGGGYGC  120
GGVMKSMQGK GPFTLTQWAE LEQQALIYKY ITANVPVPSS LLISIQKSFF PYGSLPPSSF  180
GWGTFHLGFA GGNMDPEPGR CRRTDGKKWR CSRDAVPDQK YCERHINRGR HRSRKLVEVQ  240
SNQTAAAAAA ASKAVTAQQQ SVAAGGINRN RSLTTAAQYI NPSNNRVQSQ VYPSTVNLQP  300
KESPKPRNNN SSFEFGHISS DSLVNPHNHS SWPEELKSDW TQLSMSIPVA SSSSSSPSST  360
GEDKTTLSPL RLSQESEQET TLKKVNTWIP ISWGNSLGGP LGEVLNSTTN SPTLGSSPTG  420
VLQKSTTFCP LSNSPVAESN NNFRYTT
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN6989880.0JN698988.1 Brassica rapa subsp. pekinensis growth-regulating factor 2P mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009138528.10.0PREDICTED: growth-regulating factor 2-like
SwissprotQ8L8A80.0GRF2_ARATH; Growth-regulating factor 2
TrEMBLM4DMW40.0M4DMW4_BRARP; Uncharacterized protein
STRINGBra017851.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14542886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.10.0growth-regulating factor 2