PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009138373.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 266aa    MW: 29299.4 Da    PI: 5.1747
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009138373.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.84.4e-1993153257
                     T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                     r+R+t+t+ ql++Le+ F +   +ps++++++++++l     + e++V++WFqNrRa+ k+
  XP_009138373.1  93 RQRWTPTPVQLQILERIFDQgIGTPSKQKIKDITEELsqhgPIAEQNVYNWFQNRRARSKR 153
                     89*****************99*****************9999*****************97 PP

2Wus_type_Homeobox1018.3e-3393155365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        r+RWtPtp Q++iLe+++++G+ tP+k++i++it+eL+++G i ++NV++WFQNr+aR+++kq
     XP_009138373.1  93 RQRWTPTPVQLQILERIFDQGIGTPSKQKIKDITEELSQHGPIAEQNVYNWFQNRRARSKRKQ 155
                        79***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.55E-1787155IPR009057Homeodomain-like
PROSITE profilePS5007113.86489154IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.2E-1591156IPR009057Homeodomain-like
SMARTSM003892.4E-1391158IPR001356Homeobox domain
CDDcd000864.06E-1293155No hitNo description
PfamPF000466.5E-1793153IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MMEWDNQQQA SNNPSSNLQG IDANGGSGSG GMYVKGMTDE QLETLRKQIA IYATICERLV  60
EMHKTLTSQQ DLAGRVGGLY ADPTFGHKMT GGRQRWTPTP VQLQILERIF DQGIGTPSKQ  120
KIKDITEELS QHGPIAEQNV YNWFQNRRAR SKRKQHGGGG GGGVGSSNNN NGETEVETDQ  180
TETVNEKRKM PESLLVLPDG NNNNGIGTTS ATSPRAEEDL CFHCPEMSSD LHLLGVLSNP  240
RDEHLVGKMG MSESYNLYDH VEDYGM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146154RRARSKRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.205710.0bud| leaf| root| silique
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00617PBMTransfer from AT4G35550Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009138373.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009138373.10.0PREDICTED: WUSCHEL-related homeobox 13-like isoform X1
SwissprotO817881e-128WOX13_ARATH; WUSCHEL-related homeobox 13
TrEMBLM4DMI50.0M4DMI5_BRARP; Uncharacterized protein
STRINGBra017720.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46202851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.11e-117WUSCHEL related homeobox 13
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Dolzblasz A, et al.
    Stem Cell Regulation by Arabidopsis WOX Genes.
    Mol Plant, 2016. 9(7): p. 1028-39
    [PMID:27109605]