PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009138318.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GATA
Protein Properties Length: 266aa    MW: 29933.6 Da    PI: 6.5046
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009138318.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA512e-16175208134
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                     C +Cgt +Tp+WR gp g+ktLCnaCG+++++ +
  XP_009138318.1 175 CCHCGTNNTPQWRTGPVGPKTLCNACGVRFKSGR 208
                     99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.9E-7721264IPR016679Transcription factor, GATA, plant
SMARTSM004011.3E-12169219IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.71E-13172232No hitNo description
Gene3DG3DSA:3.30.50.101.2E-12173206IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.648173205IPR000679Zinc finger, GATA-type
CDDcd002021.89E-14174231No hitNo description
PROSITE patternPS003440175200IPR000679Zinc finger, GATA-type
PfamPF003205.0E-14175209IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MELWTEARAL KASLRGEAIK HQVTVSSEEL SRTSSAEDFS VECFLDFSEE GQEEELVSVT  60
SSQEEQEQDC CIYSSQPCMF DQLPSLPDEY VEELEWVSRV VDDCSSPEVS LLFTQTHKTK  120
ASFSSSVPVK PRTKRSRNSL TGDRVWPLVS TKQHATGEQG RKKKQETAVV FQRRCCHCGT  180
NNTPQWRTGP VGPKTLCNAC GVRFKSGRLC PEYRPAASPT FSNEIHSNLH RKVMELRKSK  240
VLVEETGEAT TKSDQVKFAI NMVDKT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.16590.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3527710.0AK352771.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-03-P20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009138318.10.0PREDICTED: GATA transcription factor 3-like
RefseqXP_009138319.10.0PREDICTED: GATA transcription factor 3-like
RefseqXP_009138320.10.0PREDICTED: GATA transcription factor 3-like
RefseqXP_013724977.10.0PREDICTED: GATA transcription factor 3-like
RefseqXP_013724978.10.0PREDICTED: GATA transcription factor 3-like
SwissprotQ8L4M61e-141GATA3_ARATH; GATA transcription factor 3
TrEMBLA0A078I5Y40.0A0A078I5Y4_BRANA; BnaA03g52990D protein
TrEMBLM4DMD70.0M4DMD7_BRARP; Uncharacterized protein
STRINGBra017670.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57392647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34680.21e-142GATA transcription factor 3