PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009137820.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 552aa    MW: 60407.1 Da    PI: 8.6147
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009137820.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.81.2e-14131170141
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                     ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ +
  XP_009137820.1 131 QKKKHCNCKHSRCLKLYCECFASGTYCDG-CNCINCFNNVD 170
                     589**************************.********986 PP

2TCR51.22.5e-16210248139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     k++kgCnCkks ClkkYCeCf+a+  Cse+CkC dCkN 
  XP_009137820.1 210 KHNKGCNCKKSGCLKKYCECFQANILCSENCKCLDCKNF 248
                     589***********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.2E-17131171IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.639132250IPR005172CRC domain
PfamPF036385.0E-11133168IPR005172CRC domain
SMARTSM011147.5E-19210251IPR033467Tesmin/TSO1-like CXC domain
PfamPF036387.4E-13213248IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 552 aa     Download sequence    Send to blast
MFREEGGESL WKTKKKKKKK KLHKSAQRSH SENLDPYPPT EREVFQMGNA GGGGKLPPKN  60
DGGFGAPARD PARQLDEHSR PKPAPTVVTS SLHPVAMSQS QILNAPIRLS RQESPQSRPM  120
PIVEGRDGTP QKKKHCNCKH SRCLKLYCEC FASGTYCDGC NCINCFNNVD NEPARRDAVE  180
ATLERNPNAF RPKIAHGVRD KREEMVLLGK HNKGCNCKKS GCLKKYCECF QANILCSENC  240
KCLDCKNFDG SEERQALFHG EHANNMAYLQ QAGNAAITGA VGFSGFAPYP ASKRRKGGQD  300
ISFSHATKDT SSATGPSKFV YRSLLADVIH PQDVKALCSV LVAVAGEAAK TLLTDKRNEN  360
RVGDHTETSL ASSAQENSQG DVEMAEPDGN QADKSRGKPL SPATLALMCD DEEDTMFMIA  420
ASEPNGSVDP GGCRTNSQGQ SQNYAELERV VLTKLRDCLS RLISYAEFKE SKCSYLARRH  480
IQSPPAATDT VKMENGIQQV PPIVNGASRA TSQPTVNKPQ LFQPMQTTTN TSSTHHPHKP  540
PALPEKKDPL NQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A5e-3113325911132Protein lin-54 homolog
5fd3_B5e-3113325911132Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11420KKKKKKK
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers. {ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009137820.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009137820.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLM4E5W70.0M4E5W7_BRARP; Uncharacterized protein
STRINGBra024171.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein