PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009137653.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NZZ/SPL
Protein Properties Length: 266aa    MW: 28812.8 Da    PI: 7.5938
Description NZZ/SPL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009137653.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NOZZLE266.11.4e-8112661314
          NOZZLE   1 matslffmstdqnsvrnpnellrntrlvvnssgeirte.tkksrgrkpgsktaqqkqkkptlrgmgvaklerfiieeekkklvvatvgdtssvaa 94 
                     ma+slffm  dq    npne+lrnt+lv n s ei te +++s gr pgs t++qk kk  lrgmgva+ler +ieee k++v a  g  +    
  XP_009137653.1   1 MAASLFFMPRDQ----NPNEFLRNTYLV-NDSSEIPTEpPQNSHGRIPGSETGNQKPKKQVLRGMGVARLERLRIEEEWKNMVLAQGGRGA---- 86 
                     9**********9....5**********9.999******999********************************************999876.... PP

          NOZZLE  95 isntatrlpvpvdrgvvlqgfps.slgssrilcgg...vgsgqvmidpvispwgfvetsatthelssisnpqmynassnnrcdtcfkkkrldgdq 185
                      s +atr p   d+gvvlqgfps   g+  + +gg    gsgq+   pv spwg v ts+  he ss++ pq+yn s  + cd+c+k++r++   
  XP_009137653.1  87 -SPNATRSP---DPGVVLQGFPSyGTGGHNMSVGGytrNGSGQI---PVYSPWGVVGTST--HEPSSVPTPQVYNPSNIH-CDACYKRQRINE-- 169
                     .6789****...***********768889999999444599998...9**********98..*************99888.*********964.. PP

          NOZZLE 186 nnvvrsngggfskytmipppmngydeyllqsdhhqrsqgflydqriaraasvsaasasinpyfneatnltgsreefgsvlegnprngsrgvkeye 280
                        vr+ngggf +              +l++d  qrsqgf+yd+riar  + ++as+             gs+eefgs     prng++ vkey+
  XP_009137653.1 170 --EVRANGGGFPH--------------FLPPD--QRSQGFFYDHRIARYPASPSAST-----------NQGSMEEFGSG---SPRNGTGDVKEYQ 232
                     ..47*******64..............58899..**************984444443...........369******96...************* PP

          NOZZLE 281 ffpgkydervskvakvaslvgdcspn..tidlslkl 314
                     ffpg  +++   v  v+++vgdcsp+  tidl+lkl
  XP_009137653.1 233 FFPGSDGNK--SVSSVSTSVGDCSPDtsTIDLTLKL 266
                     ****87765..466799********9889*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF087441.5E-813266IPR014855Plant transcription factor NOZZLE
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MAASLFFMPR DQNPNEFLRN TYLVNDSSEI PTEPPQNSHG RIPGSETGNQ KPKKQVLRGM  60
GVARLERLRI EEEWKNMVLA QGGRGASPNA TRSPDPGVVL QGFPSYGTGG HNMSVGGYTR  120
NGSGQIPVYS PWGVVGTSTH EPSSVPTPQV YNPSNIHCDA CYKRQRINEE VRANGGGFPH  180
FLPPDQRSQG FFYDHRIARY PASPSASTNQ GSMEEFGSGS PRNGTGDVKE YQFFPGSDGN  240
KSVSSVSTSV GDCSPDTSTI DLTLKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009137652.10.0PREDICTED: uncharacterized protein LOC103861687 isoform X1
RefseqXP_009137653.10.0PREDICTED: uncharacterized protein LOC103861687 isoform X2
SwissprotO818369e-77SPL_ARATH; Protein SPOROCYTELESS
TrEMBLA0A078JD170.0A0A078JD17_BRANA; BnaA03g58770D protein
TrEMBLM4DRB30.0M4DRB3_BRARP; Uncharacterized protein
STRINGBra019056.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27330.15e-78sporocyteless (SPL)