PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009137623.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family BBR-BPC
Protein Properties Length: 287aa    MW: 32212.4 Da    PI: 9.8407
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009137623.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind55.91.9e-1711201100
       GAGA_bind   1 mdddgsre..rnkg.yye...................paaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernka 73 
                     m++ g++e  r  + yy+                   ++++l   +++++ms++aerda+++er+ al++k++a+a+rd+a+  rdkal+ r++a
  XP_009137623.1   1 MESGGQYEngRYNPdYYKegthsvwnampnhhqtkedQHNALV--MNQKIMSILAERDAALKERDDALAAKQEALAARDEALDLRDKALSLRDNA 93 
                     7888888778888889989999999999999888765556677..99************************************************ PP

       GAGA_bind  74 lverdnkllalllvenslasalpvgvq 100
                     ++erd++l al+++e++l+  l+ +  
  XP_009137623.1  94 ILERDSALSALQFREHNLNYILSRAKL 120
                     *****************9955544433 PP

2GAGA_bind247.77.9e-76142286154300
       GAGA_bind 154 qrakkpkekkakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvst 248
                     + +k++k++k++   k +++ +++v++++  ++ +++++s  ++ln v++De+t+PvP+C+CtG+ r CYkWGnGGWqS+CCttt+S yPLP+++
  XP_009137623.1 142 APSKRKKKRKQETRSKGKRVGEDHVASPG--KKCRKDWDSNVVGLNLVTFDETTMPVPMCTCTGTARHCYKWGNGGWQSSCCTTTLSLYPLPQMP 234
                     34455555555555555666777788888..579************************************************************* PP

       GAGA_bind 249 krrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvti 300
                     ++r++R++grKmS+++f++lL++La++G+dls pvDLkd+WA+HGtn+++ti
  XP_009137623.1 235 NKRHSRVGGRKMSGNVFSRLLSRLAGQGHDLSSPVDLKDYWARHGTNRYITI 286
                     ***************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012268.0E-1281287IPR010409GAGA-binding transcriptional activator
PfamPF062175.4E-8622286IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MESGGQYENG RYNPDYYKEG THSVWNAMPN HHQTKEDQHN ALVMNQKIMS ILAERDAALK  60
ERDDALAAKQ EALAARDEAL DLRDKALSLR DNAILERDSA LSALQFREHN LNYILSRAKL  120
GASQSSHLPN PSPLSTIPHE AAPSKRKKKR KQETRSKGKR VGEDHVASPG KKCRKDWDSN  180
VVGLNLVTFD ETTMPVPMCT CTGTARHCYK WGNGGWQSSC CTTTLSLYPL PQMPNKRHSR  240
VGGRKMSGNV FSRLLSRLAG QGHDLSSPVD LKDYWARHGT NRYITIM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1144150KRKKKRK
2144151KRKKKRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.206150.0bud| root| seed
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and pistils. {ECO:0000269|PubMed:14731261}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00480DAPTransfer from AT4G38910Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009137623.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895210.0AC189521.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB091M07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009137623.10.0PREDICTED: protein BASIC PENTACYSTEINE5-like
RefseqXP_009138239.10.0PREDICTED: protein BASIC PENTACYSTEINE5-like
RefseqXP_009138877.10.0PREDICTED: protein BASIC PENTACYSTEINE5-like
RefseqXP_018508066.10.0PREDICTED: protein BASIC PENTACYSTEINE5-like
RefseqXP_018508091.10.0PREDICTED: protein BASIC PENTACYSTEINE5-like
RefseqXP_018508118.10.0PREDICTED: protein BASIC PENTACYSTEINE5-like
SwissprotF4JUI31e-156BPC5_ARATH; Protein BASIC PENTACYSTEINE5
TrEMBLM4D5X90.0M4D5X9_BRARP; Uncharacterized protein
STRINGBra011886.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40902659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38910.21e-141basic pentacysteine 5