PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009137594.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 529aa    MW: 58325.8 Da    PI: 6.2467
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009137594.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.42e-30175231259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     dDgynWrKYGqK vkgse+prsYY+Ct+++C+vkkkvers+ +++++ei+Y   Hnh 
  XP_009137594.1 175 DDGYNWRKYGQKLVKGSEYPRSYYKCTHPNCEVKKKVERSR-EGHITEIIYVKAHNHL 231
                     8****************************************.***************5 PP

2WRKY101.16.4e-32355412259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK+vkg+++prsYY+Ct +gC+v+k+ver+++d + v +tY g+Hnh 
  XP_009137594.1 355 EDGYRWRKYGQKVVKGNPNPRSYYKCTANGCNVTKHVERASDDLTSVLTTYIGKHNHA 412
                     8********************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182901.96E-24172233IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.1E-27172233IPR003657WRKY domain
SMARTSM007744.0E-32174232IPR003657WRKY domain
PfamPF031061.6E-23175230IPR003657WRKY domain
PROSITE profilePS5081122.205175233IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.4E-34339414IPR003657WRKY domain
SuperFamilySSF1182909.94E-28346414IPR003657WRKY domain
PROSITE profilePS5081134.578349414IPR003657WRKY domain
SMARTSM007741.9E-36354413IPR003657WRKY domain
PfamPF031061.6E-24355411IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MPGFDNNFAV MGEWLDPSPN HKKRSKAELE REVYLEDIKN KGFLHASFQE KPCYSSNGLS  60
ERIAARTGFK VQRLKTESIF PSRCLAISSP AVSPATLLES PVFLSNPLTS PTTGKLSSLP  120
SDKAKDEFND EIATSLALSL DPTTNIGSEP DDSQAYEQAH DSDLGDSMPS GSPEDDGYNW  180
RKYGQKLVKG SEYPRSYYKC THPNCEVKKK VERSREGHIT EIIYVKAHNH LKPPTKSRSV  240
TGLSGTSNDM QIDGTGTNEN LQWTSPVSEE VGYGSHSGSM QGQSGAQFGY GGVANAAFSK  300
DEEDRTSYMS VSLGYHGQID ESEPKRRKLE TSGSTRGTRE PKVVVKTTSD IDILEDGYRW  360
RKYGQKVVKG NPNPRSYYKC TANGCNVTKH VERASDDLTS VLTTYIGKHN HAVPAARNSN  420
RHVNYPMPHS SSEELVTANS SLHDFQPYLR SPSGFSVYYV GETELTDISM SGLPIEQERF  480
LGLEALAIGD PDGLMLQLAA EPKVEQVSQQ ELGLSRSSLI DIMSRLPQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-31175415878Probable WRKY transcription factor 4
2lex_A8e-31175415878Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009137594.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4300510.0KF430051.1 Brassica rapa WRKY transcription factor 34 (WRKY34) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013741551.10.0probable WRKY transcription factor 34
SwissprotO655900.0WRK34_ARATH; Probable WRKY transcription factor 34
TrEMBLM4DRG20.0M4DRG2_BRARP; Uncharacterized protein
STRINGBra019105.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM141811524
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26440.10.0WRKY DNA-binding protein 34
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Hu X, et al.
    Proteasome-mediated degradation of FRIGIDA modulates flowering time in Arabidopsis during vernalization.
    Plant Cell, 2014. 26(12): p. 4763-81
    [PMID:25538183]
  3. Lei R, et al.
    Arabidopsis WRKY2 and WRKY34 transcription factors interact with VQ20 protein to modulate pollen development and function.
    Plant J., 2017. 91(6): p. 962-976
    [PMID:28635025]