PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009137421.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRF
Protein Properties Length: 418aa    MW: 45648.4 Da    PI: 7.1659
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009137421.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC771.9e-24171215145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+ep+rC+RtDGKkWRCsr+v++++k+CErH h++r rsrk++e+
  XP_009137421.1 171 DMEPWRCKRTDGKKWRCSRNVVPDQKYCERHAHKSRPRSRKHVET 215
                     79****************************************997 PP

2QLQ50.65.9e-18106139235
             QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqai 35 
                     aF+ aQ+q+L++Q  ++Ky++a++PvP+eLl + 
  XP_009137421.1 106 AFSEAQWQELERQRNIFKYMMASLPVPSELLSPF 139
                     8******************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.1E-10105141IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.2E-12106138IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.697106141IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.317171215IPR014977WRC domain
PfamPF088791.3E-19172214IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0009941Cellular Componentchloroplast envelope
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MGTRAERNKE DFVGGFGFGV VEHSHKDVML PSHHYHSYSS PASASFCYCS NGVADPIFSA  60
SNTSTLGEMF SLGGSNSTAG VSVADPFFTL TSSEMGRSMS GKEGAAFSEA QWQELERQRN  120
IFKYMMASLP VPSELLSPFS RNHTNNHDVT VARGGSLKLG IASNASNNTA DMEPWRCKRT  180
DGKKWRCSRN VVPDQKYCER HAHKSRPRSR KHVETPSHSH HNDARTTKNV ASQFATAYPQ  240
FYGPPLSQFS AVSTLPPASS SYDHHHSGLR WLMKEGDSIA TLNPEIHEAA QLKVGSSREL  300
KRGFEYDLNY IQNDPLVDQR FGALEGLLSP NRQETRRFLV EGEQDEAMGS SLTLSMAGGG  360
GMEEGEGRSQ HQWISHEGPS WLCSTTPGGP LAEALCLGVS NNPSTSTTTT SSCSRSSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009137421.10.0PREDICTED: growth-regulating factor 8-like isoform X2
SwissprotQ9SU440.0GRF8_ARATH; Growth-regulating factor 8
TrEMBLA0A078FDG40.0A0A078FDG4_BRANA; BnaA03g46480D protein
STRINGBra019244.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24150.10.0growth-regulating factor 8