PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009136908.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 312aa    MW: 34986.1 Da    PI: 6.7233
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009136908.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY108.43.4e-34166223259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+vers +dp+vv++tYeg+Hnh+
  XP_009136908.1 166 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCNVKKRVERSFQDPTVVITTYEGQHNHP 223
                     8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381303.7E-1061312IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.801.1E-35150225IPR003657WRKY domain
SuperFamilySSF1182909.81E-30157225IPR003657WRKY domain
PROSITE profilePS5081132.856160225IPR003657WRKY domain
SMARTSM007748.0E-40165224IPR003657WRKY domain
PfamPF031062.0E-26166223IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MSNETKDFYN YQFPSSFSLY DMMNLPTSAP SSYGNNGFDL SSYSFTDCLQ SSPGAYDSLL  60
QKNFGLSPSS SEVFNSSIDQ ESKRDVSNDV TGETPTRVSA PSSSSEADHP GEDSGKSQIR  120
KRELAEDGGE ENQNSKKVGK TKKNEEKKQR EPRVSFMTKS EVDHLEDGYR WRKYGQKAVK  180
NSPYPRSYYR CTTQKCNVKK RVERSFQDPT VVITTYEGQH NHPIPTNLRG NSAAAAMYSD  240
FMTPRSFTHD MFRTAAYTSG GSVEGALDYG YGQSGYGSVN ANPNSSHQNY HQGGEYELLK  300
EILPSIFFKQ EH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-29156225877Probable WRKY transcription factor 4
2lex_A1e-29156225877Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.315650.0bud
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00440DAPTransfer from AT4G18170Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009136908.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4300450.0KF430045.1 Brassica rapa WRKY transcription factor 28 (WRKY28) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288987.10.0probable WRKY transcription factor 28
RefseqNP_001303234.10.0probable WRKY transcription factor 28
SwissprotQ8VWJ21e-179WRK28_ARATH; WRKY transcription factor 28
TrEMBLA0A3P5ZRU00.0A0A3P5ZRU0_BRACM; WRKY transcription factor
TrEMBLM4D8040.0M4D804_BRARP; WRKY transcription factor
STRINGBra012614.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15242693
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18170.11e-169WRKY DNA-binding protein 28
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Kim SH, et al.
    Characterization of a Novel DWD protein that participates in heat stress response in Arabidopsis.
    Mol. Cells, 2014. 37(11): p. 833-40
    [PMID:25358503]
  4. Zhao L, et al.
    KLU suppresses megasporocyte cell fate through SWR1-mediated activation of WRKY28 expression in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(3): p. E526-E535
    [PMID:29288215]