PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009136157.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 447aa    MW: 49213 Da    PI: 8.2161
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009136157.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.32.1e-30104162160
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     ++DgynWrKYGqK vkg+ef rsYYrCt+++C++kk++ers   +++v+++Y geH+h+k
  XP_009136157.1 104 MEDGYNWRKYGQKLVKGNEFVRSYYRCTHPNCKAKKQLERSP-GGQIVDTVYFGEHDHPK 162
                     58****************************************.***************85 PP

2WRKY106.51.4e-33277335159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ++Dgy+WrKYGqK+vkgs++prsYYrC+s+gCpvkk+vers++d+k++++tYeg+H+h+
  XP_009136157.1 277 VNDGYRWRKYGQKSVKGSPYPRSYYRCSSSGCPVKKHVERSSRDTKMLIMTYEGNHDHD 335
                     58********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.33299163IPR003657WRKY domain
SuperFamilySSF1182908.37E-25100163IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.7E-26100163IPR003657WRKY domain
SMARTSM007741.4E-34104162IPR003657WRKY domain
PfamPF031068.1E-24105161IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.3E-34263337IPR003657WRKY domain
SuperFamilySSF1182902.75E-28271337IPR003657WRKY domain
PROSITE profilePS5081134.13272337IPR003657WRKY domain
SMARTSM007741.1E-37277336IPR003657WRKY domain
PfamPF031062.1E-26278334IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MAEVGKVLVS DNSSETKKAP DVVVVASPDK MEATPVATET EQCSAEIPES TDSKKLLQPV  60
PASVSEEVVV ASEKAPKVPE TGTVLTLQSG TEGSSSPFIR EKVMEDGYNW RKYGQKLVKG  120
NEFVRSYYRC THPNCKAKKQ LERSPGGQIV DTVYFGEHDH PKPLGGGGAA IPINQDRRSD  180
VLTAVSKEKS SGSSSVQTHQ PPKVHGGLHL SVVPMADEVK TDVSPSSRIK SDITHKDNIS  240
PASKRRKKGG SIEQIPMERP NNESRNVVHT QTLFDIVNDG YRWRKYGQKS VKGSPYPRSY  300
YRCSSSGCPV KKHVERSSRD TKMLIMTYEG NHDHDMPPGR IVTHNNTLDS EVDDKEPSGK  360
DPEVNKTPQS SALITKEEHH LKKKAKSNGL EKSLDQGPVL DAKPMEEIKE RSEVTKDQAA  420
KTKSDANTSR TMESEEEQKP KEESGQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A4e-45103339176WRKY transcription factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1380386LKKKAKS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.314070.0flower
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed to similar levels in root and flower, to a somewhat lower level in stem and to low levels in leaf and siliques. {ECO:0000269|PubMed:8972846}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Binds to a 5'-CGTTGACCGAG-3' consensus core sequence which contains a W box, a frequently occurring elicitor-responsive cis-acting element. {ECO:0000269|PubMed:8972846}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00094SELEXTransfer from AT2G04880Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009136157.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:17264121}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9123890.0EU912389.1 Brassica napus WRKY1-1 transcription factor (WRKY1-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009136157.10.0PREDICTED: WRKY transcription factor 1
SwissprotQ9SI370.0WRKY1_ARATH; WRKY transcription factor 1
TrEMBLM4D9M70.0M4D9M7_BRARP; Uncharacterized protein
STRINGBra013187.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79492639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.21e-179zinc-dependent activator protein-1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Qiao Z,Li CL,Zhang W
    WRKY1 regulates stomatal movement in drought-stressed Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 91(1-2): p. 53-65
    [PMID:26820136]
  3. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]