PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009135826.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 591aa    MW: 64837.6 Da    PI: 8.4808
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009135826.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.68.1e-16311349240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+C+CkkskClk+YCeCfa+g++C  +C+C dC+Nk 
  XP_009135826.1 311 SCKRCHCKKSKCLKLYCECFASGVYCIVSCSCVDCFNKP 349
                     689**********************************96 PP

2TCR50.34.7e-16397436140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+gCnCkks+C+kkYCeC+++g+ Cs +C+Ce+CkN  
  XP_009135826.1 397 RHKRGCNCKKSNCVKKYCECYQSGVGCSINCRCEGCKNAF 436
                     589***********************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.7E-18310351IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.278311437IPR005172CRC domain
PfamPF036381.9E-11313348IPR005172CRC domain
SMARTSM011142.8E-16397438IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.4E-11399435IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 591 aa     Download sequence    Send to blast
METPQKTIIQ NGTAVSKLKN SPVFNYINNL SPIKPVRSIP IAQTFGSLSP SVYTPPHKGS  60
RFKSHTYFSD PAKELVEEAL LETVPPKILK NDCISTPPSR AAANDGSCGD GKTDLQKLCD  120
GNVKRKSDTP DWETQFPDTP EMLIYDTLND SEADRCFLPA SSDLKRRSCG GTKPRLEPVS  180
NSKELADALH RGVRRRLLDF EMPDNQTSEK SSSSCVVPPS TGLHLNTAFA MSSKDTNEYS  240
LSANIKVGLQ NSTPPVLHSH DILRENETGE AAGQSVVEEI QKSSLALVEM NQSSPKKKRL  300
KSDQAGEGES SCKRCHCKKS KCLKLYCECF ASGVYCIVSC SCVDCFNKPI HEDTVLATRK  360
QIESRNPIAF APKVIRNTDS SIMEAGVDAS KTPASVRHKR GCNCKKSNCV KKYCECYQSG  420
VGCSINCRCE GCKNAFGKKD VSSFVGMDIK QDGESKTGQT QQNNELFSYV PLPPSTPMSL  480
RQPLAQLPIS SNNMLLPQQS QQLHGASGSF LYENQSFRKQ GMGLLSRTET ITEDIENVIP  540
SPITNINAVS PNSKRVSLPH LDPPVLTPRR RNGERKLLLS IPAFPSLPPH H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1631543414120Protein lin-54 homolog
5fd3_B2e-1631543414120Protein lin-54 homolog
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers and at significant levels in leaves. Detected with highest levels in developing ovules and microspores, and in petals. {ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009135826.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893270.0AC189327.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB037A01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009135826.10.0PREDICTED: protein tesmin/TSO1-like CXC 3
SwissprotQ8L5480.0TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
TrEMBLA0A398A4M30.0A0A398A4M3_BRACM; Uncharacterized protein
STRINGBra001884.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]