PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009135824.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 664aa    MW: 73092.6 Da    PI: 5.8789
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009135824.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR512.9e-16380418240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+CnCkkskClk+YCeCfaag++C + C+C dC+Nk 
  XP_009135824.1 380 SCKRCNCKKSKCLKLYCECFAAGVYCIDPCSCVDCFNKP 418
                     689**********************************96 PP

2TCR52.11.3e-16465503139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     ++k+gCnCkks+ClkkYCeC+++g+ Cs +C+Ce+CkN 
  XP_009135824.1 465 RHKRGCNCKKSNCLKKYCECYQSGVGCSINCRCEGCKNA 503
                     589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.4E-19379420IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.692380505IPR005172CRC domain
PfamPF036386.1E-12382417IPR005172CRC domain
SMARTSM011144.2E-17465506IPR033467Tesmin/TSO1-like CXC domain
PfamPF036386.2E-12467503IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 664 aa     Download sequence    Send to blast
MDNENSQKES ASKIETPTPK SNFEESPVFN FINNLSPFEP VKSFSSVQTF SSLSFTSPPP  60
VFTSPHPTFH RESRFFRCQN SVDRSKALDS KEEVVADVDL NKEATLEDDE ETSCELPQIL  120
SSDSQSPPHH GEDIVTQVLL PPPGEDNNGS SSEDVKMRLL NILDAQEENG TPGSRRLMAD  180
AAELLVFRSP NDSEAFTCLV DQISSSERRF CAGVKLPTQQ HDIIPANGST NDNEPLAVVP  240
NQPVSNVHRG SMRRRCLDFE IPRKRKKDDD EQTVSDNNKA ESSSSKCGLP GIGLHLNAIA  300
MASRNTKISI THEYSSSGEI QNTFSGSIAP VHSQDTVPEA LEQAESQPGE ESAVEEATEL  360
IPDSLQKKKQ VLEGGEGESS CKRCNCKKSK CLKLYCECFA AGVYCIDPCS CVDCFNKPIH  420
EDTVLATRKQ IESRNPLAFA PKVIRNSDSI MDTSDDASKT PASARHKRGC NCKKSNCLKK  480
YCECYQSGVG CSINCRCEGC KNAFGRKDAY LHAIMESKQE EDHETYEKRT ADMSKEAERN  540
PSSEQPLTPL PPYKHLVVHQ PFLPRNKLPP TQFSLGAGSS SFRKPEGESG NEKKPLETVI  600
EDKTEIMPDI LNTSPIKANS PNSKRVSPAH IGSSEPGSIL GKRSNGRKLI LRSIPAFPSL  660
NHNQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1738450214120Protein lin-54 homolog
5fd3_B2e-1738450214120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1252266RRRCLDFEIPRKRKK
2262266RKRKK
3262267RKRKKD
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at the first stage of pollen development in uninucleate microspores and bicellular pollen but not in tricellular and mature pollen. {ECO:0000269|PubMed:18057042}.
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers with highest levels in developing ovules and microspores. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009135824.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893270.0AC189327.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB037A01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009135824.10.0PREDICTED: CRC domain-containing protein TSO1-like isoform X1
SwissprotQ9LUI30.0TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLM4CCF40.0M4CCF4_BRARP; Uncharacterized protein
STRINGBra001884.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  2. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  3. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]