PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009135363.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 118aa    MW: 13266.4 Da    PI: 8.8983
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009135363.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.11.4e-3851041100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C+kdC+++pyfp ++p kf ++h+++Ga  v+k+l++lp ++r +a++sl +eA++r++dPvyG+vg+i+ lq +++++++ la
  XP_009135363.1   5 RCAACKYLRRRCPKDCIFSPYFPPSDPDKFSCIHRIYGAGDVSKMLQQLPVQTRAEAVESLSFEAKCRVEDPVYGCVGIISLLQTHIQKTQTLLA 99 
                     6********************************************************************************************99 PP

          DUF260  96 llkee 100
                     ++++e
  XP_009135363.1 100 KTQAE 104
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.4144105IPR004883Lateral organ boundaries, LOB
PfamPF031955.6E-385102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
MNPKRCAACK YLRRRCPKDC IFSPYFPPSD PDKFSCIHRI YGAGDVSKML QQLPVQTRAE  60
AVESLSFEAK CRVEDPVYGC VGIISLLQTH IQKTQTLLAK TQAEIAVAQT KHSQHTNL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0566091e-106DQ056609.1 Arabidopsis thaliana putative LOB domain protein (At3g26620) mRNA, complete cds.
GenBankAB4738471e-106AB473847.1 Arabidopsis thaliana ASL14 mRNA for ASYMMETRIC LEAVES2-like 14 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009135363.11e-84PREDICTED: LOB domain-containing protein 24-like
SwissprotP594682e-72LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A078CL062e-80A0A078CL06_BRANA; BnaC03g38310D protein
STRINGAT3G26660.16e-70(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.11e-73LOB domain-containing protein 24