PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009135348.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRF
Protein Properties Length: 363aa    MW: 41135.2 Da    PI: 8.6879
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009135348.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.21.5e-2381124144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrCrRtDGKkWRCsr++ +++k+CE+H+hrgr+r +k  +
  XP_009135348.1  81 DPEPGRCRRTDGKKWRCSREAHPDSKYCEKHMHRGRNRAKKALD 124
                     79*************************************99766 PP

2QLQ64.52.7e-221651237
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                    +FT++Q+q+L++Q+l+yKy+++++PvPpeL++ i++
  XP_009135348.1 16 PFTPTQWQELEHQALIYKYMVSGVPVPPELILSIRR 51
                    9*******************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.3E-141551IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.2E-161650IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166624.1431651IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.89881125IPR014977WRC domain
PfamPF088793.3E-2082122IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MMNLSGTSGR TIERPPFTPT QWQELEHQAL IYKYMVSGVP VPPELILSIR RSLDSSLVSR  60
LLPHQSIGWG CYQMGSGRKP DPEPGRCRRT DGKKWRCSRE AHPDSKYCEK HMHRGRNRAK  120
KALDQNQTIA PSTSPSLSFP NKDNPISPTL SSSSSSFIDT YSRFGVGSSN SRGYFNNHSL  180
DYPYPSSCSP KQQQTLEHAS ALSLHQNKSS ISQFNVLASE TDHKDFRHFQ GIGERTFFPE  240
ASKSFQESPY HHQEALATAM NDPYHGSSSD HHHTYSSSSS SSRQRDHHQQ QQHFVLGADE  300
FNKPTRTVFS NTPRQGHQEE EEKDSPKIKK SLHHFFGEDW AQIKNTSDSW LDLSSQSRLD  360
TGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN1803010.0JN180301.1 Brassica rapa subsp. pekinensis growth-regulating factor 5 (GRF5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009135348.10.0PREDICTED: growth-regulating factor 5-like isoform X2
SwissprotQ8L8A61e-168GRF5_ARATH; Growth-regulating factor 5
TrEMBLG1FER10.0G1FER1_BRARP; Growth-regulating factor 5
STRINGBra001532.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-144growth-regulating factor 5