PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009133993.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRF
Protein Properties Length: 518aa    MW: 55446.4 Da    PI: 9.2713
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009133993.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.33.7e-25197240144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e
  XP_009133993.1 197 DPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKPVE 240
                     79***************************************998 PP

2QLQ51.53e-18133169137
             QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                     ++F+ +Q+++L++Q+l+yKy+ an+PvP+ Ll+ ++k
  XP_009133993.1 133 GPFSLTQWAELEQQALIYKYITANVPVPSSLLLSLKK 169
                     59******************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.3E-10133169IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.1E-12134166IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.723134169IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.954197241IPR014977WRC domain
PfamPF088793.3E-21198240IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
MDLGVRFEGS VSGHENGSPG QTELGSGFGN KQERSGFDGE DFWRSSKLSR TLIDGFSSSS  60
AAAKTLSFHQ GIPLLRSTSV DPRRQEQMLS FSPASDKSDV SPYLQYCRNS GYGLGGMMNT  120
NSMHGSLLTG AKGPFSLTQW AELEQQALIY KYITANVPVP SSLLLSLKKS FFPYGSLPPN  180
SFGWGSFHLG FSGGNMDPEP GRCRRTDGKK WRCSRDAVPD QKYCERHINR GRHRSRKPVE  240
GLNGHNTNAT AAASAASKAA AATTVVATRG SDNNNSLAAV GTHHHHAIPS MANSDRVQNA  300
QGASVFPATM NLQSKESHQK QSSSPFEFGL ISSDSLLNPS HKQASYANSS KGFGSYLDFS  360
NQAKNSNVDS WTEELKSDWT QLSMSIPMAP SSPVQDKLAL SPLRLSREFD PAIHMGLGVN  420
TEFLEPVKKA NNWIPISWGN NNNSMGGPLG EVLNSTTNSP KFGSSPTGVL QKSTFGSLSN  480
SSSGSSTVLG DNSNKNCDGK DPLGPTTLMN SSAPAPSM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN6989860.0JN698986.1 Brassica rapa subsp. pekinensis growth-regulating factor 1 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009133993.10.0PREDICTED: growth-regulating factor 1
SwissprotO810010.0GRF1_ARATH; Growth-regulating factor 1
TrEMBLK4GWY80.0K4GWY8_BRARP; Growth-regulating factor 1 (Fragment)
STRINGBra000575.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14542886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.10.0growth-regulating factor 1