PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009133704.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRF
Protein Properties Length: 451aa    MW: 49438.1 Da    PI: 9.5779
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009133704.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.99.8e-25209252144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrCrRtDGKkWRCs+++++++k+CErH++rgr+rsrk++e
  XP_009133704.1 209 DPEPGRCRRTDGKKWRCSKDAVPDQKYCERHINRGRHRSRKPVE 252
                     79***************************************998 PP

2QLQ54.63.3e-19145181137
             QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                     ++FT +Q+++L++Q+l+yKy+ an+PvP+ Ll  iqk
  XP_009133704.1 145 GPFTLTQWAELEQQALIYKYITANVPVPSSLLISIQK 181
                     59*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.1E-12145181IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.884146181IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.7E-13146180IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.479209253IPR014977WRC domain
PfamPF088794.9E-21210252IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MDLGSVTGNV NGSPSLKELR ESKQDRSGFD GEDCLQQSSK LARTIAEDKH LPSSYAAAYS  60
RPMSFHQGIP LARSASLLSS DSRRQEHMLS FSDKPEAFDF SKYVGLDNNK NSLSPFLHQL  120
PPPYCRTPGG GYGSGGMMMS MQGKGPFTLT QWAELEQQAL IYKYITANVP VPSSLLISIQ  180
KSFYPYRSFP PSSFGWGTFH LGFAGGKMDP EPGRCRRTDG KKWRCSKDAV PDQKYCERHI  240
NRGRHRSRKP VEVQPGQTAA SKAVASRNTA SQSPNNRVQN VIYPSTVNLP PKEQRNNNNS  300
SFGFGHVTSP SLLTSSYLDF SINQNKPEEL KSDWTQLSMS IPVTSSSPSS TAQDKTALSP  360
LRLDLPIQSQ QETLEAARKV NTWIPISWGN SLGGPLGEVL NSTTSSPTLG SSPTGVLQKS  420
TFCSLSNSSS VTSPVADNNR NNNVDYFHYT T
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN6989870.0JN698987.1 Brassica rapa subsp. pekinensis growth-regulating factor 2J mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009133704.10.0PREDICTED: growth-regulating factor 2
SwissprotQ8L8A80.0GRF2_ARATH; Growth-regulating factor 2
TrEMBLM4D5M40.0M4D5M4_BRARP; Uncharacterized protein
STRINGBra011781.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14542886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.11e-160growth-regulating factor 2