PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009133687.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 215aa    MW: 24801.5 Da    PI: 9.3095
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009133687.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.91.8e-32142199158
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                     ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh
  XP_009133687.1 142 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNH 199
                     59******************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.2E-34127199IPR003657WRKY domain
SuperFamilySSF1182901.31E-28134199IPR003657WRKY domain
PROSITE profilePS5081129.585137199IPR003657WRKY domain
SMARTSM007741.3E-37142201IPR003657WRKY domain
PfamPF031063.1E-25143199IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MRLNQMEGGG KERRVVVNTY YDQQQEKMNS PFEETNVLTF FSSSSSSLSS PSFPIYNSSS  60
TTNTSYAPLG FSNNLQGGGP LGSKVVNDDQ DNIRGGINND VHYNSWWRSS SESGEMKNKV  120
KIRRKLREPR FCFQTKSDVD VLDDGYKWRK YGQKVVKNSL HPRSYYRCTH NNCRVKKRVE  180
RLSEDCRMVI TTYEGRHNHI PSDDSPERDH CLSSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-26133199874Probable WRKY transcription factor 4
2lex_A2e-26133199874Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120126KIRRKLR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009133687.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ1688390.0GQ168839.1 Brassica rapa subsp. pekinensis WRKY12 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009133687.11e-161PREDICTED: probable WRKY transcription factor 12 isoform X2
SwissprotQ93WY41e-110WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLM4C8341e-155M4C834_BRARP; Uncharacterized protein
STRINGBra000362.1-P1e-156(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.11e-108WRKY family protein
Publications ? help Back to Top
  1. Yu Y, et al.
    MlWRKY12, a novel Miscanthus transcription factor, participates in pith secondary cell wall formation and promotes flowering.
    Plant Sci., 2013. 212: p. 1-9
    [PMID:24094048]
  2. Yang L, et al.
    PtrWRKY19, a novel WRKY transcription factor, contributes to the regulation of pith secondary wall formation in Populus trichocarpa.
    Sci Rep, 2016. 6: p. 18643
    [PMID:26819184]
  3. Li W,Wang H,Yu D
    Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions.
    Mol Plant, 2016. 9(11): p. 1492-1503
    [PMID:27592586]
  4. Han Y, et al.
    WRKY12 represses GSH1 expression to negatively regulate cadmium tolerance in Arabidopsis.
    Plant Mol. Biol., 2019. 99(1-2): p. 149-159
    [PMID:30617455]