PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009133140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 423aa    MW: 46381.5 Da    PI: 9.854
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009133140.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.21.1e-30158214360
                     -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     DgynWrKYGqK+vkgs++prsYY+Ct+++Cpvkkkvers   + v ei+Y+geHnh+k
  XP_009133140.1 158 DGYNWRKYGQKQVKGSDCPRSYYKCTHPKCPVKKKVERSM-GGLVSEIVYQGEHNHSK 214
                     9***************************************.9**************85 PP

2WRKY102.91.8e-32343400259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dg++WrKYGqK+v g+ +prsYYrCtsa+C+++k+ver+++dp+++++tYeg+Hnh+
  XP_009133140.1 343 EDGFRWRKYGQKVVGGNAHPRSYYRCTSANCRARKHVERASDDPRAFITTYEGKHNHH 400
                     8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-26153215IPR003657WRKY domain
SMARTSM007743.4E-32156214IPR003657WRKY domain
SuperFamilySSF1182907.85E-24157215IPR003657WRKY domain
PROSITE profilePS5081122.481158215IPR003657WRKY domain
PfamPF031065.8E-24158212IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.1E-32330400IPR003657WRKY domain
PROSITE profilePS5081131.697337402IPR003657WRKY domain
SuperFamilySSF1182902.88E-27337400IPR003657WRKY domain
SMARTSM007742.4E-38342401IPR003657WRKY domain
PfamPF031065.2E-26343400IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010214Biological Processseed coat development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MEVKESKRVV IAKPVASRPS FTSIRTFANL LTDSVTVSPP HETVDAAIRP KTLRFKQPAA  60
AAASVSCPQV EGNDKGKSCD DSDTKSYVVY KPKAKLVSQA TVSALANMLQ GNHQQVWRQS  120
EAVPYGKSVS QGTRPNLVPR VPSFKESETS AGDRSSVDGY NWRKYGQKQV KGSDCPRSYY  180
KCTHPKCPVK KKVERSMGGL VSEIVYQGEH NHSKPSCPLP RRASSSSSSG FQRPQRELAS  240
EGSIGQDSSN VCFHPLWSNQ SNDSSKSIAE KMNEGCVITP FEFAVPRSAN STGGTSDSGC  300
RSSSQCDEGE LDDPSRSKRS RKNEKQASQT GVSQSSVESD SLEDGFRWRK YGQKVVGGNA  360
HPRSYYRCTS ANCRARKHVE RASDDPRAFI TTYEGKHNHH LNLRPPTSPT LPFTSSQHSN  420
QAI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-28158401978Probable WRKY transcription factor 4
2lex_A4e-28158401978Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Leaf promordia, trichomes, atrichoblasts, fertilized eggs, seed coat.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Regulates trichome development, production of mucilage and tannin in seed coats, and maybe root hair development. {ECO:0000269|PubMed:12084832}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009133140.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced by salicylic acid or wounding. {ECO:0000269|PubMed:12084832}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ0121680.0FJ012168.1 Brassica napus WRKY44 transcription factor (WRKY44) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009133138.10.0PREDICTED: WRKY transcription factor 44 isoform X1
RefseqXP_009133139.10.0PREDICTED: WRKY transcription factor 44 isoform X1
RefseqXP_009133140.10.0PREDICTED: WRKY transcription factor 44 isoform X1
SwissprotQ9ZUU00.0WRK44_ARATH; WRKY transcription factor 44
TrEMBLA0A3P5ZYZ60.0A0A3P5ZYZ6_BRACM; Uncharacterized protein
STRINGBra023112.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.10.0WRKY family protein
Publications ? help Back to Top
  1. Kim K,Jiang K,Teng SL,Feldman LJ,Huang H
    Using biologically interrelated experiments to identify pathway genes in Arabidopsis.
    Bioinformatics, 2012. 28(6): p. 815-22
    [PMID:22271267]
  2. Simon M, et al.
    Tissue-specific profiling reveals transcriptome alterations in Arabidopsis mutants lacking morphological phenotypes.
    Plant Cell, 2013. 25(9): p. 3175-85
    [PMID:24014549]
  3. Ranocha P,Francoz E,Burlat V,Dunand C
    Expression of PRX36, PMEI6 and SBT1.7 is controlled by complex transcription factor regulatory networks for proper seed coat mucilage extrusion.
    Plant Signal Behav, 2014. 9(11): p. e977734
    [PMID:25531128]
  4. Verweij W, et al.
    Functionally Similar WRKY Proteins Regulate Vacuolar Acidification in Petunia and Hair Development in Arabidopsis.
    Plant Cell, 2016. 28(3): p. 786-803
    [PMID:26977085]
  5. Gonzalez A, et al.
    TTG2 controls the developmental regulation of seed coat tannins in Arabidopsis by regulating vacuolar transport steps in the proanthocyanidin pathway.
    Dev. Biol., 2016. 419(1): p. 54-63
    [PMID:27046632]
  6. Hassani-Pak K, et al.
    Developing integrated crop knowledge networks to advance candidate gene discovery.
    Appl Transl Genom, 2016. 11: p. 18-26
    [PMID:28018846]