PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009133081.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRF
Protein Properties Length: 368aa    MW: 40351.7 Da    PI: 8.5911
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009133081.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC811e-25137181145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRCsr+v  g+k+CErH+hrgr+rsrk++e+
  XP_009133081.1 137 DPEPGRCRRTDGKKWRCSRDVFVGHKYCERHMHRGRNRSRKPVET 181
                     79****************************************996 PP

2QLQ52.81.2e-1872108137
             QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                     s F+ aQ+q+L+ Q+l+y+y++a++ vP+eLl++i+k
  XP_009133081.1  72 SFFSSAQWQELELQALIYRYMLAGAAVPQELLLPIKK 108
                     67*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.4E-1172108IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.35173108IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.3E-1374106IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166726.23137181IPR014977WRC domain
PfamPF088791.4E-21138180IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006995Biological Processcellular response to nitrogen starvation
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009624Biological Processresponse to nematode
GO:0009631Biological Processcold acclimation
GO:0016036Biological Processcellular response to phosphate starvation
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0050826Biological Processresponse to freezing
GO:0051365Biological Processcellular response to potassium ion starvation
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0005524Molecular FunctionATP binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MDLQLKQWRS KQVQTESEPQ PSAAKIPRHA FDPIQSQTAT STVLPLFAPE PASSKLSSLC  60
PDSSSRFSKM GSFFSSAQWQ ELELQALIYR YMLAGAAVPQ ELLLPIKKSL LHLSPSYFLH  120
HLPHYQPAWY LGRGAMDPEP GRCRRTDGKK WRCSRDVFVG HKYCERHMHR GRNRSRKPVE  180
TPIVNATTTT SMASPATAAP SSTPSSFAFG GGEEVGQGGS SSFFFSSQSC SEVKQESNNN  240
KRPYESHYGF GSNGSDGGHI LRHFFDDWPR SEADNSSSPM SSATCLSISM PGNSSSDVSL  300
KLSTGNEEEA RSNNIGRDQQ NMSWWSGGGT NHNHHHMGGP LAEALRSSSS SSPTSVLHQL  360
GVSTQAFH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0264721e-166BT026472.1 Arabidopsis thaliana At2g36400 mRNA, complete cds.
GenBankAY1026361e-166AY102636.1 Arabidopsis thaliana transcription activator (GRF3) mRNA, complete cds.
GenBankAK1174171e-166AK117417.1 Arabidopsis thaliana At2g36400 mRNA for unknown protein, complete cds, clone: RAFL17-02-B13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009133081.10.0PREDICTED: growth-regulating factor 3-like
SwissprotQ9SJR50.0GRF3_ARATH; Growth-regulating factor 3
TrEMBLM4E2R50.0M4E2R5_BRARP; Uncharacterized protein
STRINGBra023066.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19262667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.11e-104growth-regulating factor 4