PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009133059.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TALE
Protein Properties Length: 658aa    MW: 71747.2 Da    PI: 6.755
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009133059.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-093794161954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  XP_009133059.1 379 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 416
                     554459******************************88 PP

2BELL87.51.4e-28248302155
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlk 55 
                     erqe+q+kkakL s+l+eV++rY+qy++q+q+vissFe++ag+gsak+YtslAl 
  XP_009133059.1 248 ERQEIQMKKAKLSSMLHEVEQRYRQYHQQMQMVISSFEQAAGIGSAKSYTSLALX 302
                     79***************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.8E-57168307IPR006563POX domain
PfamPF075263.5E-36174301IPR006563POX domain
PROSITE profilePS5007112.26357420IPR001356Homeobox domain
SMARTSM003892.3E-9360424IPR001356Homeobox domain
CDDcd000869.68E-13360421No hitNo description
SuperFamilySSF466895.56E-17361427IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.2E-29363426IPR009057Homeodomain-like
PfamPF059202.7E-18377416IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 658 aa     Download sequence    Send to blast
MAAYFHGNPP EISAGTDGGL QTLILMNPTT YVPYTQQDDD SNNSNNNTNN NNFVFLDSRA  60
PPQNANQQFV GIPLSGHEAA SITAADNISV LHGYPPRVQY SLYGSHQVDP THHQAACETP  120
RAQRGLSLTL SSQQQQQQHR QTLHHVGFGS GPGEDIRVGS GSTASGVTNG VANLVSSKYL  180
RAAQELLDEV VKADSNDITI KSQLFSSKKG TSVTDTKAVG ESSTGAREGS DGGGEASGKR  240
TVELGTAERQ EIQMKKAKLS SMLHEVEQRY RQYHQQMQMV ISSFEQAAGI GSAKSYTSLA  300
LXEAIAGQIK AANKSLGEED SVSGVGRFEG SRLKFVDHHL RQQRALQQLG MIQHPSNNAW  360
RPQRGLPERA VSVLRAWLFE HFLHPYPKDS DKHMLAKQTG LTRSQVSNWF INARVRLWKP  420
MVEEMYAEEM KEQGKNMGSM EKTPNLDENI DDSASKSTSN QEKIPMGGGG LDNYHLNPGH  480
NGELEGVTGM QESPKRLRTS DGTMMQPINE GFSSNEKMKI LEERQGIRSD GGYPFMGSFG  540
QYQMDEMSRF NVAVSDQELL TQRFSGNNNG VSLTLGLPHC DSLSSTHHQG FMQTHHGIQI  600
GRSVKIGETE EYGNSAINGG SGSAATAHSS AAAAAAYNGM NIQNQKRYVA QLLPDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B5e-17366423158Homeobox protein Meis1
4xrs_A5e-17366423158Homeobox protein Meis1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.37420.0leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009133059.10.0PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A078CR560.0A0A078CR56_BRANA; BnaC03g19820D protein
STRINGBra023045.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.30.0BEL1-like homeodomain 1