PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009133026.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family BBR-BPC
Protein Properties Length: 228aa    MW: 25165.2 Da    PI: 10.3727
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009133026.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind241.36.6e-7449228118301
       GAGA_bind 118 qledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaderskaekksidl.vlngvslDestlPvP 211
                     q e+    +  +  l  +p++   ++++   k+++  +++k++++k ++kk+  +++k  +k+ s  ++ k+ekk+ d+ v++  s+D s++P+P
  XP_009133026.1  49 QAEPAELAMVPQVRLFPPPTRGYIHDVE--LKSSTMLSPSKALKPKPQSKKR--SAPKTPKKTLSI-PEIKREKKNPDInVVDISSFDVSGVPPP 138
                     5555555555555555555444333222..2333345666777777776666..444444444444.689*********889999********** PP

       GAGA_bind 212 vCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     vCsCtG++++CYkWG+GGWqS+CCt++iS++PLP+st+r+g+R+agrKmS+ga+ klL +La+eGydl +pvDL++hWA+HGtnkfvti+
  XP_009133026.1 139 VCSCTGVPKVCYKWGMGGWQSSCCTISISTFPLPMSTTRPGTRLAGRKMSNGAYVKLLMRLAGEGYDLTCPVDLRNHWARHGTNKFVTIK 228
                     *****************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012263.7E-791228IPR010409GAGA-binding transcriptional activator
PfamPF062173.6E-6579228IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MDPYLSRNHM KPATSTSKDT GLPTSNPLWF HSYYPVPRTT GIDLSQPPQA EPAELAMVPQ  60
VRLFPPPTRG YIHDVELKSS TMLSPSKALK PKPQSKKRSA PKTPKKTLSI PEIKREKKNP  120
DINVVDISSF DVSGVPPPVC SCTGVPKVCY KWGMGGWQSS CCTISISTFP LPMSTTRPGT  180
RLAGRKMSNG AYVKLLMRLA GEGYDLTCPV DLRNHWARHG TNKFVTIK
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and pistils. Detected in anthers, in pollen grains, in young rosette, in leaf vasculature, in the lateral and primary roots, in embryo sac, and in the whole ovule. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:21435046}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009133026.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018513635.11e-168PREDICTED: protein BASIC PENTACYSTEINE7 isoform X2
SwissprotO822861e-111BPC7_ARATH; Protein BASIC PENTACYSTEINE7
TrEMBLM4E2L21e-167M4E2L2_BRARP; Uncharacterized protein
STRINGBra023013.1-P1e-168(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM136742127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35550.11e-114basic pentacysteine 7