PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009132954.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SBP
Protein Properties Length: 137aa    MW: 15994.5 Da    PI: 6.3599
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009132954.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1339.9e-4259136178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqve+C+ad+s+ak+yh+rhkvCe+h+kapvv +sg  qrfCqqCsrfhel+efDe+krsCrrrLa+hnerrrk+++
  XP_009132954.1  59 CCQVERCTADMSRAKQYHKRHKVCEFHAKAPVVRISGGYQRFCQQCSRFHELREFDEAKRSCRRRLAGHNERRRKSTN 136
                     6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375751.2E-551137IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.102.2E-3253121IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.82957134IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.84E-3758135IPR004333Transcription factor, SBP-box
PfamPF031104.8E-3260133IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MSARRSNAEG KRSLIEMSEE EEQEEDDDDT FVEEDGEEEE EEASEKKQKG KATSSSGVCC  60
QVERCTADMS RAKQYHKRHK VCEFHAKAPV VRISGGYQRF CQQCSRFHEL REFDEAKRSC  120
RRRLAGHNER RRKSTNE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-3850133184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2411461e-178AC241146.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH072P15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009132954.11e-94PREDICTED: squamosa promoter-binding-like protein 3
SwissprotP930152e-59SPL3_ARATH; Squamosa promoter-binding-like protein 3
TrEMBLA0A078CU662e-66A0A078CU66_BRANA; BnaC03g18800D protein
TrEMBLA0A0D3B4R82e-66A0A0D3B4R8_BRAOL; Uncharacterized protein
STRINGfgenesh2_kg.4__1394__AT2G33810.12e-58(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.11e-56squamosa promoter binding protein-like 3