PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009132700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SBP
Protein Properties Length: 342aa    MW: 37435.4 Da    PI: 8.1687
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009132700.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.33.4e-41104181178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +C v+gC++d+s+++eyh+rhkvC+vhsk+pvv+++g +qrfCqqCsrfh l+efDe+k+sCr+rL++hn+rrrk+q+
  XP_009132700.1 104 ICLVDGCDSDFSNCREYHKRHKVCDVHSKTPVVTINGNNQRFCQQCSRFHGLEEFDEGKKSCRKRLDGHNRRRRKPQP 181
                     5**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.6E-3297166IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.505102179IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.35E-38103184IPR004333Transcription factor, SBP-box
PfamPF031105.0E-30105178IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MDWNFKLSSG YFSEFDQESV PDLTPVDASI SFGGSSSPPR RLQPKGDLPF DLKLGRNIGH  60
SSSSSSSSAF GKTEKVISLS KLKESASEAS RSSKRTRGNN QIPICLVDGC DSDFSNCREY  120
HKRHKVCDVH SKTPVVTING NNQRFCQQCS RFHGLEEFDE GKKSCRKRLD GHNRRRRKPQ  180
PDHTDRTATF FQGSKLLDFS SSPHVFPTTS VVSPSWGSGP VSVAMANGSS YGQNQSYVGS  240
FPAKTGITFP ISSSPNSRGK QFPFLQEEED SSRMTSCIHD SDCALSLLSS SSSHLLQPQP  300
PLSLSQETVF YGSGLFENAS AVSDGSGNEA VPLPQTFPPF HW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-2998178484squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1161178KKSCRKRLDGHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009132700.10.0PREDICTED: squamosa promoter-binding-like protein 13A
RefseqXP_009132699.10.0PREDICTED: squamosa promoter-binding-like protein 13A
RefseqXP_009132698.10.0PREDICTED: squamosa promoter-binding-like protein 13A
SwissprotB9DI201e-165SP13A_ARATH; Squamosa promoter-binding-like protein 13A
SwissprotP0DI111e-165SP13B_ARATH; Squamosa promoter-binding-like protein 13B
TrEMBLM4E1W60.0M4E1W6_BRARP; Uncharacterized protein
STRINGBra022766.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-141SBP family protein