PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009130778.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GATA
Protein Properties Length: 496aa    MW: 55272 Da    PI: 8.0201
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009130778.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA50.33.3e-16741135
            GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                    C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  XP_009130778.1  7 CYHCGVTSTPLWRNGPPEKPVLCNACGSRWRTKGS 41
                    ****************88888***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004016.5E-10155IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.76E-11546No hitNo description
CDDcd002024.52E-16655No hitNo description
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PfamPF003205.7E-14741IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.0E-12740IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
PfamPF139192.8E-10270369IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 496 aa     Download sequence    Send to blast
MGKQGPCYHC GVTSTPLWRN GPPEKPVLCN ACGSRWRTKG SLVNYTPLHS RADGEENKDH  60
QRYQRMKSIS VNNKYKETKT LKRKAIQEPV LEFNYGFKKA VVEEDASNRS SSGSAISNSE  120
SCAQFSSADG SELTGPSQSN AWDTTVPCKR RTCMGLRPKT SSVEKLTQDL YNILQEQQSS  180
VSSGEEDLLF ENEMLSMVSV EIGHGSVLMR NPHSFAREEV SEEASCLSSV ENKSSISDAY  240
SSHSVKRAEI GAERGSVSVG QSVKEEQLKR TKSQNGRVHV LGSHGSPLCS IDLKDVFNFD  300
EFIEQFTEEE QKKLMRLLPQ IDSVNLPDSL RMMFESAQFK ENFSLFQKLI ADGVFEMPSS  360
TSEARLEEMR TFKKLALSDF RKSRLVESYN LLKEGDKGSA TTTSRSSNPN VHKHIVTIKR  420
RCENQTQLKS ESRGLMRSPK SVTKMKASYE GNGSCFSQRS LASVFAQGNC SSDQDLLLLD  480
LPSNGSFPQA ELLHQL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3532400.0AK353240.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-27-J12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009130778.10.0PREDICTED: GATA transcription factor 26-like isoform X2
SwissprotQ8W4H10.0GAT26_ARATH; GATA transcription factor 26
TrEMBLM4FGD90.0M4FGD9_BRARP; Uncharacterized protein
STRINGBra040167.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.30.0GATA transcription factor 26