PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009130474.1
Common NameWRKY51
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 198aa    MW: 22290.6 Da    PI: 7.5387
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009130474.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY87.89.5e-28108166159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +dDgy+WrKYG+K+vk++++ r+YY+C+s+gC+vkk+ver+ e+  +v++tYeg Hnhe
  XP_009130474.1 108 MDDGYKWRKYGKKSVKNNTNKRNYYKCSSEGCMVKKRVERDGENAAYVITTYEGVHNHE 166
                     59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.3E-3095168IPR003657WRKY domain
SuperFamilySSF1182901.96E-26100168IPR003657WRKY domain
PROSITE profilePS5081128.839103168IPR003657WRKY domain
SMARTSM007741.5E-31108167IPR003657WRKY domain
PfamPF031064.0E-22109166IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MNPSQSPSPN FTFLSDENSI YSVMDNYDFS NLMFSVGEGG SNGLIQEETS SPTTIVTGES  60
GGSGSAFTTL RKKESTSLDC KNRGSKDGET KEMGHRVAIR TRSKIDVMDD GYKWRKYGKK  120
SVKNNTNKRN YYKCSSEGCM VKKRVERDGE NAAYVITTYE GVHNHESPSH VYYSDMVFDH  180
DNWKQHSLLQ SIQTFPPC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-2398169778Probable WRKY transcription factor 4
2lex_A2e-2398169778Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.288291e-110leaf
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009130474.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4300600.0KF430060.1 Brassica rapa WRKY transcription factor 51 (WRKY51) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288926.11e-148probable WRKY transcription factor 51
SwissprotQ93WU96e-98WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLV5RF861e-147V5RF86_BRACM; WRKY transcription factor 51
STRINGBra031900.1-P1e-145(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57112747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.11e-100WRKY DNA-binding protein 51
Publications ? help Back to Top
  1. Tang J, et al.
    Characterization and co-expression analysis of WRKY orthologs involved in responses to multiple abiotic stresses in Pak-choi (Brassica campestris ssp. chinensis).
    BMC Plant Biol., 2013. 13: p. 188
    [PMID:24267479]
  2. Yan C, et al.
    Injury Activates Ca2+/Calmodulin-Dependent Phosphorylation of JAV1-JAZ8-WRKY51 Complex for Jasmonate Biosynthesis.
    Mol. Cell, 2018. 70(1): p. 136-149.e7
    [PMID:29625034]