PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009129495.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 121aa    MW: 13836.1 Da    PI: 8.7745
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009129495.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.26.5e-3951041100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaC++lrr+C+kdCv++p fp ++p+kfa+vh+++Ga nv+k+l++lp ++r +a++sl++eA +r++dPvyG+vg+i+ lq q+++++  la
  XP_009129495.1   5 RCAACRYLRRRCPKDCVFSPFFPPNNPEKFACVHRIYGAGNVSKMLQQLPVQTRAEAVESLCFEATCRIEDPVYGCVGMISLLQTQIQKTERLLA 99 
                     6*****************************************************************************************99999 PP

          DUF260  96 llkee 100
                     ++++e
  XP_009129495.1 100 RTQAE 104
                     98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.2724105IPR004883Lateral organ boundaries, LOB
PfamPF031958.3E-395102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MNPKRCAACR YLRRRCPKDC VFSPFFPPNN PEKFACVHRI YGAGNVSKML QQLPVQTRAE  60
AVESLCFEAT CRIEDPVYGC VGMISLLQTQ IQKTERLLAR TQAEITVSQI KHSQNQHSEF  120
M
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009129493.15e-87PREDICTED: LOB domain-containing protein 24-like
RefseqXP_009129494.15e-87PREDICTED: LOB domain-containing protein 24-like
RefseqXP_009129495.15e-87PREDICTED: LOB domain-containing protein 24-like
RefseqXP_009129496.15e-87PREDICTED: LOB domain-containing protein 24-like
RefseqXP_013721028.15e-87PREDICTED: LOB domain-containing protein 24-like
SwissprotP594684e-74LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A078IG675e-87A0A078IG67_BRANA; BnaA02g28140D protein
STRINGBra032938.1-P7e-80(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.11e-63LOB domain-containing protein 24